(data stored in ACNUC7421 zone)

EMBL: CP000821.PE247

CP000821.PE247       Location/Qualifiers
FT   CDS_pept        complement(280758..281210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0247"
FT                   /product="protein of unknown function DUF1332"
FT                   /note="KEGG: shn:Shewana3_3955 protein of unknown function
FT                   DUF1332"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34860"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT7"
FT                   /protein_id="ABV34860.1"
FT                   /translation="MIAKLKKFLSSHSQAVTPEEQARQLNLAAVSLLLEVVFADETLST
FT                   EEAKLLPTLLTSALSLTQAEAEELVDEAKKIQGNSISLYEFTHEINQQCSIEQKQKLIL
FT                   AMWKLAYADGQLCRYENQIIRRTSALLHLKHSELIQMRNLAIESQR"
     atgattgcga aattaaaaaa gtttctgagt tcacactcac aagccgtgac gccggaagag        60
     caggctcgtc agcttaattt ggccgcagtg agcttactgt tggaagtggt atttgccgac       120
     gagaccttgt ctacggagga agctaaactt ctgcctacac ttttaacttc tgcgctgtca       180
     ttgactcaag ccgaggcaga agagttggta gatgaagcga agaagataca ggggaactcg       240
     atttcactct atgaattcac ccatgagatc aatcagcaat gtagtattga acagaaacaa       300
     aaactgatcc tcgccatgtg gaaactcgcc tacgccgatg gccagttatg tcgctatgaa       360
     aatcagataa ttcgccgcac atcggctctg cttcacctga aacacagcga actgatccag       420
     atgcgtaacc tggccataga gagccagcgc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page