(data stored in ACNUC7421 zone)

EMBL: CP000821.PE248

CP000821.PE248       Location/Qualifiers
FT   CDS_pept        complement(281329..281913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34861"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT8"
FT                   /protein_id="ABV34861.1"
FT                   /translation="MFLLKKLECSQYSDLFTTGRLTMKLSAVTGLLLGSLMMSSPATAG
FT                   WFDDLTSKKEVKPQVTQTQSSDLVGSVMSQLGLNQSQAEGGLGSLFSLAQSTLGSDDFG
FT                   PIASAIPNMDSLLSAAPAIDSGSGISGLLSQAGDLGASLQGGAQIYDAFEKLGISKELA
FT                   VPMIDIVKGYLDANAGNGTTDLLIKGLGAIL"
     atgtttttgt taaaaaagct agaatgctcg caatattcgg atttattcac cactggaagg        60
     ctaacaatga aactatctgc tgtgacaggc ttactactcg gcagcctaat gatgagctca       120
     cctgcaacgg caggttggtt tgacgatcta acgtcaaaga aagaggtgaa accccaggta       180
     acacaaaccc agagcagtga cctcgttggc agtgttatgt cgcagctcgg actcaatcag       240
     tctcaggctg agggaggctt gggcagcttg ttttctctgg ctcaatccac attaggtagt       300
     gatgacttcg gaccgatagc cagtgccatt ccaaacatgg atagcctact ctctgcggcc       360
     ccggctatcg atagtggctc gggaatttcc ggactcctct ctcaagccgg cgatctgggg       420
     gcttctctgc aaggtggcgc tcaaatctat gatgccttcg agaagcttgg gatctcaaaa       480
     gagcttgcgg ttcctatgat agatattgtc aaaggctact tagatgccaa tgcaggcaat       540
     ggcaccacag atctcttgat caaagggtta ggtgcgattc tttaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page