(data stored in ACNUC7421 zone)

EMBL: CP000821.PE249

CP000821.PE249       Location/Qualifiers
FT   CDS_pept        282032..282748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34862"
FT                   /db_xref="GOA:A8FPT9"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT9"
FT                   /protein_id="ABV34862.1"
FT                   /translation="MSLSAIFTEAYNFFRNHISQLAALTVPILFIQVGIQLWLGMEMAN
FT                   ADLENPQFGALHMAAVMALLLVFSLLIASLTLFMEIRSQGHEANTALILKTSLSFVPPL
FT                   LLAGVFSGLAILAPVMLFAAFGPLWLVGLVISIYIFARLAYVNFMVVVERLTPLEAIKG
FT                   SFKFSGAIAFKTLLVLMLYIPLSLIGGTLSSLAQDAVGFPLQLIVEVFIAFIGLFVNVA
FT                   LFRLYMVSRPKVEEQA"
     atgtcattgt ccgcgatatt taccgaagca tataacttct ttcgcaatca tattagtcag        60
     ttagctgctc tcactgttcc tattctattt attcaggtag gtattcaact ttggttgggt       120
     atggagatgg cgaacgcaga tctggaaaat cctcagtttg gtgcgctgca tatggcggcc       180
     gtaatggcgt tgctactggt attctctctg ctgatcgcat ctttaacact cttcatggag       240
     atacgttcac agggacatga agcgaatacg gcgcttattc ttaaaacgag tttgagtttc       300
     gtacctccac tactgctcgc gggggtattc tctggtttag ctatcttagc gcctgtcatg       360
     ctatttgctg ccttcggacc gctatggctg gtgggactgg tcattagtat ctatattttc       420
     gccagattgg cctacgtaaa cttcatggtg gttgtcgagc gattaactcc tctggaagcg       480
     attaagggaa gctttaagtt cagtggtgct atagcattca aaaccctgtt ggtgttgatg       540
     ctttatatcc cattgtcttt gataggtggt acgctctcgt ctttagcaca agatgcagtt       600
     ggcttcccac ttcagttgat cgttgaagtc tttattgcct tcattgggct tttcgtcaac       660
     gttgcgctgt tccgtttata tatggtgtca cgtcctaaag tggaagagca ggcttaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page