(data stored in ACNUC7421 zone)

EMBL: CP000821.PE25

CP000821.PE25        Location/Qualifiers
FT   CDS_pept        31167..31781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0025"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="KEGG: slo:Shew_0021 protein of unknown function
FT                   UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34638"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP65"
FT                   /protein_id="ABV34638.1"
FT                   /translation="MTDSYQVPSAELVIEEEIKHSRFISVLFHCQSYEELKCVLTNVKA
FT                   DYPGASHYCYAFVAAEPQNSIAIGSSDDGEPAGSAGRPMLATLQGANVGEIGAIVVRYF
FT                   GGTKLGVGGLVRAYSSGIKQGLTQLQTELKQIRYPGSLVCEYSQLKDVEYLLNQYDAVV
FT                   EDRSFAEKVTLEFEIPKRYQETLNLGLATMSQGMLSAKFKS"
     ttgaccgata gttatcaggt tccatcggct gagctggtga ttgaggagga gattaagcat        60
     agccgcttca tatctgtttt attccattgt cagtcttacg aagaactgaa gtgtgtactt       120
     actaacgtga aggctgatta tccaggggcc agccattatt gctatgcatt tgtcgctgcg       180
     gaaccacaaa atagtattgc tataggctca agtgacgacg gagagcctgc cggaagtgcc       240
     ggacgcccta tgctggcgac gctacagggg gccaatgttg gagagatcgg cgccattgtc       300
     gtacgttatt tcggtggcac aaaattgggt gttggtggac tcgtcagggc ctacagctca       360
     ggaattaaac aagggctcac tcaactgcag actgagttga agcagattag atatcccggc       420
     tccttggtgt gtgagtatag ccagctaaaa gatgttgagt atctattgaa tcaatatgat       480
     gcagttgtcg aagatagatc ttttgcagaa aaggtgacac ttgagtttga gatcccaaag       540
     cgttatcaag agacgttgaa tctcggtttg gctacgatga gtcaggggat gttgtcggca       600
     aagtttaaga gttag                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page