(data stored in ACNUC7421 zone)

EMBL: CP000821.PE250

CP000821.PE250       Location/Qualifiers
FT   CDS_pept        282807..284225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0250"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="KEGG: slo:Shew_3592 Sel1 domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34863"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU0"
FT                   /protein_id="ABV34863.1"
FT                   /translation="MLTDVEFVTQFSTELGHDYGVAKSYVRDVPTQALLQIRSFTHKLT
FT                   ELLAKPKRITFDSPNLYDRIEMLNRKRVINVRTTRALHKLRGDGNRGAHPEKYHLTSEQ
FT                   LLELSEKSIEKLLSLVASLFTQVTTNPLPEYRFEAFDSFAGRDLCYRAVMESDPQAQYL
FT                   VGMSLKTKALMQREQEQALAEPEEEQGSPPDKFSDSTFKKAEYWFTQAADSNMDALYES
FT                   GVALIHGYSGKVDIAAGEQVIAAAAEANVANAMALLGYFHLVGGESIKLDSDKALHYLQ
FT                   LAADLEQSEAIANLGVLFYQRGDLEKAKHFIAKAAQAGFPHAQYHLALMLARGEGCDAD
FT                   SIAGEQWMAEAAEQGQVDAMLARAQSMLNDDNAFGCDLSQAELYLREAIKYGHSVPAMI
FT                   ELSIALADGMLGKIDVVGSAALLKLARERSNPQELAVIEPLWESLSLQVENVLSMTDNT
FT                   DEVASLQRAKELLS"
     gtgcttactg atgtcgaatt cgttactcag ttttctactg agctgggcca tgattacggg        60
     gtagccaaaa gctatgtccg ggatgtcccc acccaagcct tgcttcaaat ccgcagcttt       120
     actcataagc tgaccgagct gctggctaag cctaaacgaa taaccttcga tagccccaac       180
     ctatacgaca ggatcgaaat gcttaaccgg aagcgagtga tcaacgtgcg taccaccaga       240
     gctttgcaca aattgcgagg tgacggtaac cgcggggcac atccggaaaa gtatcacctg       300
     acttctgagc agttactcga gttaagtgaa aagtcgatag agaaactgct gagcctggtc       360
     gcgtctctgt ttactcaagt taccaccaac ccccttcccg aatatcgctt cgaagcgttc       420
     gactcttttg ccgggcggga tctctgttat cgagccgtga tggagtcaga ccctcaggcg       480
     caatacttag tcggcatgtc gcttaagact aaagccttga tgcagcgaga gcaggagcag       540
     gcgttagccg agccggagga agaacaagga tcccccccgg ataagttttc tgacagtaca       600
     ttcaaaaaag ccgagtattg gtttactcaa gccgccgata gcaatatgga tgcgctctat       660
     gaatcgggcg tggcccttat tcatggttat agcggtaagg tcgatattgc agccggtgaa       720
     caagtcattg cggccgcagc tgaggcgaat gtggctaatg ccatggcgct actcggctat       780
     tttcatctgg taggcggtga gagcattaaa cttgattcgg ataaggccct gcattatctt       840
     cagctggctg cagatcttga acaatcagaa gcaatagcca atttaggggt cctgttttat       900
     cagcgcggcg atcttgaaaa ggcgaagcat tttatcgcta aagcggctca ggcaggcttt       960
     ccccatgctc agtatcatct ggcgttaatg ttggctcgag gcgagggttg cgatgccgat      1020
     tcgattgccg gtgagcagtg gatggccgag gcggcggagc agggacaggt agatgctatg      1080
     ttggcccgcg cacaatctat gttgaatgac gataatgctt tcggttgcga cctctcacag      1140
     gccgagctgt acttacggga ggcgattaaa tatggccaca gtgtacccgc tatgattgaa      1200
     ctgagtatcg cgcttgccga tggtatgttg ggaaaaattg atgtcgtggg atctgcggcc      1260
     ctgctaaaac tggctcgtga gcggagtaat ccccaagagc tggccgtgat agaacccttg      1320
     tgggagtcac tgtccctgca ggttgaaaac gtgttgtcga tgactgataa caccgatgaa      1380
     gtcgcctctc ttcagcgggc aaaagagctg ctctcttaa                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page