(data stored in ACNUC7421 zone)

EMBL: CP000821.PE251

CP000821.PE251       Location/Qualifiers
FT   CDS_pept        284323..285573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34864"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU1"
FT                   /protein_id="ABV34864.1"
FT                   /translation="MEIPLPTASQSENERLNELAQSYVKLVLAVGMHDPFYVDAYYGPE
FT                   LWRKECQLVPLSLLDLDAKRLLCELDAVALANADAKLVSRQRFLRTQVASVGYFIRHLQ
FT                   GERGSFDVESMGLYDTQANKFSLESFDSVLTEMAGLLPGEGPLAERFEAFRSGFIVPQN
FT                   RVPQVFEAAVEKARALTGAHISLPESESFSMEFVNDKIWTAYNWYQGNYQSLIQLNQDQ
FT                   PLYIERCLELASHEGYPGHHVFNLLQEQDLVRNEQWIEYAIYPLYSPISFLSEGSANYG
FT                   LRLIMSEDEVLGFERDYLMPLAGIEGDIEHYHRVLTCYKRLAYLDNLVCEQLTDGHICV
FT                   SDAECLLRDYGLYSESRARQRVKFYLSNRAYVINYNHGEESVARWVERGGNTTPVERWR
FT                   RFEALLRRPLSASQFTI"
     atggaaatac ccttgcctac cgcttcccaa tcagaaaatg aacgactcaa tgagttggca        60
     caatcttatg taaagctggt gctcgctgtc ggtatgcatg accctttcta tgtcgacgcc       120
     tattatggcc cggagttgtg gcgcaaagag tgccagttag tgccactttc cttattggat       180
     ctcgatgcta aaagactgct ttgcgagtta gatgccgttg ccttggctaa tgccgacgct       240
     aagctggttt cacggcagag attcctgaga acacaagtcg cttcggttgg gtactttatt       300
     cgtcacctgc agggagagag gggaagtttc gatgttgaat ctatggggct atacgacact       360
     caggctaata agttcagcct ggagtctttt gattctgttc tgacggagat ggccgggtta       420
     ttaccgggtg aagggccgtt agccgaacgc ttcgaagcat tcagatccgg ttttatcgta       480
     cctcaaaaca gagtgccgca ggtgttcgag gcggcggttg agaaggcaag agctttaacc       540
     ggcgctcata tctccctgcc cgagagtgaa agtttcagca tggagtttgt caatgacaag       600
     atttggacgg cgtacaattg gtatcagggt aactatcaga gtctgataca gctcaatcaa       660
     gatcaacctc tctatatcga gcgctgcctg gagcttgcca gtcatgaagg ctatcctggc       720
     catcacgtgt ttaatctgct gcaggaacaa gatttagtca gaaatgaaca gtggatagaa       780
     tatgcgatat acccactcta tagccctatc tcatttttgt cggaaggcag tgctaactat       840
     ggcttgcgtc tgatcatgtc agaagatgaa gtgctcgggt ttgagcgtga ttatctgatg       900
     cccttagctg gcatcgaggg agatattgag cattaccata gggtgctcac ctgttataag       960
     aggttggctt atctggataa tctggtatgt gagcagttaa ccgatggcca tatctgtgtg      1020
     agtgatgccg aatgtctctt gagagattac ggattatata gcgagtcacg cgccaggcag      1080
     agggtcaagt tttatctctc taatcgtgcc tatgttatta attataatca tggtgaagag      1140
     agtgtggcgc gttgggtgga gagaggcggt aataccacac cagttgagcg ttggagacgt      1200
     ttcgaagccc tgctgagaag accgcttagc gcatctcagt ttacgatcta a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page