(data stored in ACNUC7421 zone)

EMBL: CP000821.PE252

CP000821.PE252       Location/Qualifiers
FT   CDS_pept        complement(285705..286073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34865"
FT                   /db_xref="GOA:A8FPU2"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU2"
FT                   /protein_id="ABV34865.1"
FT                   /translation="MIYSQFQQSPFQNRFSGVKGWMAFAIGLAVITLTLIALPFVLLIG
FT                   AVSFILLSLFGRIFLKRQLARFRQQQEQGVYGAQQQEADFSQANVERDSQVFTESPFAE
FT                   RRPRVTPHQGRTFEHDPS"
     atgatctaca gtcaatttca gcaatcacct ttccagaata ggttctccgg tgtcaaaggc        60
     tggatggctt tcgcgatagg tctggccgtg ataacactaa cactgatagc actaccgttt       120
     gtgttgctta tcggtgcagt cagtttcatt ttattgagcc tatttggacg tatattcctt       180
     aagaggcagc ttgcgcgttt tcgtcagcag caggaacaag gagtctacgg cgcacagcag       240
     caggaagcag atttttcaca ggccaatgta gagagagact ctcaagtatt cacagagagt       300
     ccttttgccg aacgccgtcc ccgagtgacc ccacatcaag gacgtacctt cgagcacgat       360
     ccgagctaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page