(data stored in ACNUC7421 zone)

EMBL: CP000821.PE255

CP000821.PE255       Location/Qualifiers
FT   CDS_pept        complement(288663..289553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34868"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU5"
FT                   /protein_id="ABV34868.1"
FT                   /translation="MNKTTLTLAVLLGLTSTHIYAVQDTAYQHEAEVTYAGSSESFSDG
FT                   TWNGQYRYYFTSVNQDSAPYALSGFLAQTSNLGGQYSKLDVDVDADFTTYAIDGEYVFE
FT                   DKWYIGARYQNADWDNLITKTESDTYTYEVTLGYYFNDTSSVYVNYGKYGNTTQPKYMT
FT                   SLNDISKTEVDTTSYGIGVKSYLPLSSGQGILFSALFSHSSSDAKVISPTDEYQSSDSS
FT                   DSLSAAVDWYITRSWSVGATYATSFDSDWDDPYGINTAYTLRITDGLSAKFNLTKQLEP
FT                   DMDGVFAAIGINGRF"
     atgaataaaa ccaccctaac actagccgta ctcttagggc ttacctctac acacatttac        60
     gccgttcaag atacagccta ccaacatgaa gccgaagtca cttacgcggg atccagcgaa       120
     agcttttcag acggtacatg gaacggacaa tatcgatact atttcacctc ggtcaatcag       180
     gatagcgcac cttatgcctt gagtggtttt ctcgctcaaa cttcaaatct agggggccaa       240
     tacagcaaac ttgatgttga tgttgatgct gatttcacta cctacgctat cgatggtgag       300
     tatgtcttcg aagacaaatg gtacattggc gcccgttatc aaaatgcaga ttgggacaat       360
     ttaattacaa aaactgaatc ggatacgtac acgtacgagg tcacactggg ttactacttt       420
     aacgatacct cctccgtata tgtcaattat ggcaagtatg gcaatacaac ccagccaaaa       480
     tatatgacct cactaaatga catttcgaaa accgaagtcg acacaacgtc ttacgggata       540
     ggcgttaaga gttacctccc cctatcatct ggtcagggca tcttgttctc cgcattgttc       600
     agccactcct cttctgacgc gaaagtaatc tctccaactg atgaatatca atcttcagac       660
     tcatcggata gcttaagcgc cgctgtcgat tggtatatca cccgctcctg gtctgtcggt       720
     gctacatatg cgacctcatt cgacagtgac tgggacgatc cctacggcat taacactgct       780
     tatacgttac gcataaccga tggactttcc gctaagttta atctaactaa acagttagag       840
     cccgatatgg atggtgtttt tgccgcaata ggcattaatg gacgcttcta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page