(data stored in ACNUC7421 zone)

EMBL: CP000821.PE256

CP000821.PE256       Location/Qualifiers
FT   CDS_pept        289774..290367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0256"
FT                   /product="DTW domain containing protein"
FT                   /note="KEGG: shn:Shewana3_3947 DTW domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34869"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU6"
FT                   /protein_id="ABV34869.1"
FT                   /translation="MSRPICPKCHYPLKACLCESIESMQVSTELIVLQDPSEVGHAKNS
FT                   VRLLELVIEDTQVYVGECPDDFTQLRQHLEQSVKPVYLVYPSEQSEDVESVSFDEDVIL
FT                   LFLDGTWRKAYKLLQLNPWLQGLPALHLDIESASNYKIRKASRIDSLSTLEAAAMMVKA
FT                   IEPHQEVSPLLNALNAMVNQRISSMPDSVRKRYE"
     gtgtcccgtc ccatctgtcc taaatgtcat tatccgctta aggcttgtct gtgtgagagt        60
     atcgaatcga tgcaggtatc gacggagttg attgtcttgc aagatccaag cgaagtaggg       120
     catgcgaaaa acagtgtgcg tctgctcgag ttggttatag aagatactca agtatatgtg       180
     ggagagtgcc ccgatgactt tacgcaactg cgccagcatc tcgagcaaag cgttaaacct       240
     gtctatctgg tttacccctc ggagcagagc gaggatgtcg agagtgtcag tttcgatgag       300
     gatgtgattc tgttgtttct cgatggtacc tggcgaaagg cctataaact tttacagctt       360
     aacccctggt tacaaggctt gccagcactg catctggata ttgagtctgc ttcgaattat       420
     aaaattcgaa aagcgagccg catcgatagc ctttctacat tggaagctgc ggcaatgatg       480
     gtgaaagcca ttgagccgca tcaagaggtg tcgcccctac tcaatgcatt aaatgcaatg       540
     gtaaatcaac gtattagttc gatgcctgat tctgtcagaa aacgatatga gtga             594
//

If you have problems or comments...

PBIL Back to PBIL home page