(data stored in ACNUC7421 zone)

EMBL: CP000821.PE26

CP000821.PE26        Location/Qualifiers
FT   CDS_pept        31956..33413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0026"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="KEGG: slo:Shew_0022 potassium uptake protein, TrkH
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34639"
FT                   /db_xref="GOA:A8FP66"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP66"
FT                   /protein_id="ABV34639.1"
FT                   /translation="MQYRTIIRITGLLMGLFSLSLLPPALVAVIYKDGGGTAFIQAFAL
FT                   SLFLGFILWYPNRKHHKDLRTREGFLLVVLFWGVLGSIGAVPFIFTAQPDLSMTDSFFE
FT                   SFSALTTTGATVIVGLDSLPKAILFYRHLLQWLGGMGIIVLAVAILPVLGIGGMQLYRA
FT                   EMPGPVKDSKMTPRIAETAKALWYIYFALTIACAFAYWVAGMDLFDAICHSFSTIAIGG
FT                   FSTHDASMGYFDSTAINMVCVVFLLIAALNFSLHFAAFTRRGINLKVYFRDAEFKALII
FT                   VQLVLTGICFATLYHSGIYDSPEETLDFALFQAVSISTTAGFGTESFHVWPLFLPMLLI
FT                   FSSFIGGCGGSTAGGIKVMRMILLLKQGSRELKRLVHPRGMFSIRIGNKALPERVIDAV
FT                   WGFFSAYALVFVICMLALMAMGMDNITAFSATAACLNNLGPGLGEVASNYASISDGAKW
FT                   VLLIAMLFGRLEVFTLLVLFTPTFWRT"
     atgcaatata gaacaataat aagaataaca ggcctcttaa tggggttgtt ctctctgtca        60
     ttacttcctc cggctttggt ggcagtgatc tataaagatg gtggcggaac ggcatttata       120
     caggcttttg cactcagcct ttttcttggc tttattcttt ggtatccaaa cagaaagcac       180
     cacaaagatc tgcgtacccg tgaaggcttc ctgctcgtgg ttcttttctg gggtgtgcta       240
     ggttctatcg gtgccgtgcc ctttatattt accgctcaac cagacctgag tatgaccgac       300
     agctttttcg agtcattctc ggcgctgaca actacaggtg ctactgtgat tgttggtctg       360
     gattcacttc ctaaagcaat cctgttttat cgccacctgt tgcaatggtt aggcggcatg       420
     gggatcattg tgctggctgt ggcaatatta cctgtattgg gtatcggggg gatgcagctc       480
     tatcgagcag aaatgcctgg acccgtaaaa gacagtaaga tgacgcccag gattgcagag       540
     acggctaagg cgttgtggta tatctatttt gcattaacga ttgcctgtgc atttgcttat       600
     tgggtcgcag gcatggatct atttgatgct atctgccact ctttctcgac gattgccatt       660
     ggcggtttct ccacccatga tgccagtatg ggctacttcg acagcactgc aattaacatg       720
     gtgtgtgtgg tttttctgct tatcgcggcg cttaatttta gcctgcactt cgccgctttt       780
     acacgtcgtg gaatcaacct gaaagtctat ttcagagatg ctgagtttaa ggctttaatc       840
     atagtgcagc tggttttgac cgggatctgt tttgcgactc tctaccattc ggggatctat       900
     gactcacccg aagagacatt agactttgcc ctatttcagg ctgtttcaat atctaccacg       960
     gcaggcttcg gtactgaaag cttccatgtg tggccactat tcctgccgat gttacttatc      1020
     ttctcaagtt tcattggtgg ctgtggtgga tcgaccgccg gtggtatcaa ggtgatgcgg      1080
     atgatcttgc tgttgaagca gggctcacga gaattgaaac gtcttgtaca tccaagagga      1140
     atgttctcca tccgtatagg aaacaaggcc cttcctgagc gtgttatcga tgcggtatgg      1200
     gggttcttct ctgcctatgc gctggtcttc gttatctgta tgttggcttt gatggcgatg      1260
     gggatggata atatcaccgc atttagtgct accgcggctt gcctgaataa cctggggcca      1320
     ggtctgggtg aagttgccag caactatgcc agtatcagtg atggcgctaa gtgggttctg      1380
     ctgatagcta tgctgtttgg acgactcgaa gtctttacct tattggtact gtttacacca      1440
     acattctgga gaacctaa                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page