(data stored in ACNUC7421 zone)

EMBL: CP000821.PE260

CP000821.PE260       Location/Qualifiers
FT   CDS_pept        complement(294163..294876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34873"
FT                   /db_xref="GOA:A8FPV0"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV0"
FT                   /protein_id="ABV34873.1"
FT                   /translation="MGSSTTYEFSYLNSMPCNTEVTIQVVTPSQPIRLRTRLIGVDPHR
FT                   AIIFALGSDNSWQEAKKFLKPGQPIIVRLVNSDEPDANILAFRSSIRKLLGSTEPWLII
FT                   DYPKALQKVALRQHSRIAINLEASIQVMPAEGSDEGETTQLLSPGQLSNISINGGAFIG
FT                   KILQEISVETPCLLQVKVLQEAETMSIPITIKNIQDIEYGRMRGQYGFELSGEKSETET
FT                   FVQKVILNHLLQQPK"
     gtgggaagtt caactactta cgaattttct tatttgaata gcatgccttg caatacagag        60
     gtcactattc aggtggtaac accgagtcaa cccatcaggc ttagaacgcg cctcatcggc       120
     gtcgatccac atcgtgcaat tatctttgct ttaggttcag ataacagctg gcaagaggca       180
     aaaaagtttc tcaaacccgg tcaaccgatt attgttcgcc ttgttaatag tgacgagccc       240
     gatgccaata ttctcgcctt tcgtagctct atcaggaagc tactcggcag taccgaacct       300
     tggttaatca tcgattaccc taaggcacta caaaaagtcg cactcaggca gcactcacgg       360
     atcgctatta atctggaagc cagcattcag gtaatgccag ccgaaggctc ggatgaggga       420
     gaaacaactc agcttctttc acctggacag ctaagtaata tatcgatcaa tggcggcgcc       480
     ttcatcggaa aaatacttca agaaattagc gtagagacac cctgtctgtt acaagtaaaa       540
     gtgctgcaag aggcggagac gatgtcgata cctatcacca ttaaaaatat tcaggatatt       600
     gaatatggaa ggatgcgtgg tcagtatgga tttgagttaa gtggtgaaaa gagtgaaacg       660
     gaaacctttg ttcagaaggt gatacttaac cacctgttgc aacaaccgaa atag             714
//

If you have problems or comments...

PBIL Back to PBIL home page