(data stored in ACNUC7421 zone)

EMBL: CP000821.PE261

CP000821.PE261       Location/Qualifiers
FT   CDS_pept        295106..296437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0261"
FT                   /product="peptidase M16 domain protein"
FT                   /note="KEGG: slo:Shew_3581 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34874"
FT                   /db_xref="GOA:A8FPV1"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV1"
FT                   /protein_id="ABV34874.1"
FT                   /translation="MIRKLSALIMAAGLMMTSQVSQATQVEDIKSFTLDNGMKIMVLED
FT                   ASIPNANMYLFWKVGSRNEVPGITGISHFFEHMMFNGAKKYGPKMFDRTMEAAGGANNA
FT                   YTTENITVYTDWFPANALETIFDLEADRIASLDINEKMVESERGVVASERTTGLENSNW
FT                   RTLQEEIKGAAFRAHPYSWSVIGHESDIAAWTLDDLVQYHKTYYAPNNAVVVIAGDVKL
FT                   AEVKALADKYFAPISAQAPPKEVKTVEPLQKGERRVYVHKASVSTPNVMLAYHVPSTSH
FT                   EDYYALDLLSSVLSTGNSSRLYQSLVEKQVAIEVETYLPMTFDPNLFYVMGVANPGITA
FT                   TELEKDLIAEINKVAREGVTEQELEKVKNIKLMNFYRSMETINGKANTVGTYELYFGSF
FT                   EKLFNAPEAYGKVTPADLQRVAQTYLRRANRTVAVLAAIEETDE"
     atgatccgaa aattatcggc gctgataatg gccgcggggt taatgatgac ctcgcaggtg        60
     tctcaggcga cgcaagtaga agatatcaaa agttttacac ttgataatgg catgaaaatt       120
     atggtcttgg aagatgcatc tattccaaat gccaatatgt acctgttttg gaaggtgggc       180
     tccagaaatg aggtacctgg tatcacaggt atctcgcatt tcttcgagca tatgatgttc       240
     aatggcgcaa aaaaatatgg tcccaagatg tttgaccgca ccatggaggc ggcgggaggg       300
     gctaacaatg cctatacaac ggaaaatatc acggtttata ccgattggtt tccggcgaat       360
     gcattagaga ccatattcga tctggaagca gatcgaatcg ccagtctcga tattaatgag       420
     aaaatggttg agagcgaacg aggtgtcgtc gcatcagagc gtactacagg tcttgaaaac       480
     tctaattggc gaacgctcca ggaagagatt aaaggagcgg cttttcgagc tcatccctat       540
     agctggtcag ttatcgggca tgaatcagat atcgctgcat ggacattgga tgacttagtt       600
     caatatcaca aaacctacta tgcccccaat aatgccgtgg ttgtgatagc cggtgatgtg       660
     aagctcgccg aggttaaggc tctcgcagat aagtattttg cgccaatttc cgcacaagcc       720
     cctccaaaag aggtgaagac ggtggagccg ctacaaaaag gtgagcgtcg agtctatgtg       780
     cataaggcat cagtcagcac accaaatgtg atgttggctt atcatgtacc ctcaacatcc       840
     catgaagact attacgcact cgatctgctc tcctctgtct tgagcacggg taatagttca       900
     cgcctctatc aatctctcgt tgaaaagcag gttgcgatag aggtcgaaac ttatctgccg       960
     atgaccttcg accctaacct tttctatgtc atgggtgtcg ctaaccccgg gatcacggca      1020
     acagaacttg aaaaggacct gattgcagag atcaacaagg ttgcccgtga aggggtgact      1080
     gagcaggagt tggaaaaggt aaaaaatatc aagttgatga atttctatcg ttcaatggaa      1140
     acaatcaacg gtaaagctaa taccgttgga acgtatgagc tttatttcgg gagttttgag      1200
     aagttgttta atgcgccgga agcttatgga aaagtgacgc ctgccgatct gcaacgtgtc      1260
     gcacaaactt acctgcgtcg tgcaaatcga accgttgccg tattggccgc catagaggag      1320
     acagatgaat ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page