(data stored in ACNUC7421 zone)

EMBL: CP000821.PE262

CP000821.PE262       Location/Qualifiers
FT   CDS_pept        296434..297876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0262"
FT                   /product="peptidase M16 domain protein"
FT                   /note="KEGG: slo:Shew_3580 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34875"
FT                   /db_xref="GOA:A8FPV2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV2"
FT                   /protein_id="ABV34875.1"
FT                   /translation="MKTLTHLSKSSNRLIAAIFITGMSLSGCATQTVSTPVDTGSFSMP
FT                   AYEQFKLENGLTVYLMPQKEVPLITVNAVVRAGAVNDTTSGVAGMTAQSLLLGADGKSK
FT                   SEIEQMVDFLGASIYADAGKEGSYIGADFMAKDSDKILPLIQSLLLSPDFDAAEFDKLR
FT                   QREIAGLSQAKESPRAVISRYFDKLIYGSHPYGNASSGNSVSLAELNISQLRAFHQSYY
FT                   QPANTAISVVGDFDVKQMKSTMKQLFGRWKNSEEVVTPALKSNQPELTKSQVLLVDKGD
FT                   AIETTFLIGGKGISRDNPDYVGLKVINTILGGRFTSWLNDELRVNAGLTYGARSGFIPY
FT                   SEGGIFRISTFTKTETTKETIDLALKTYARLWETGVDQKTLDSAKAYVKGQFPPKFETS
FT                   GKLAGLLSDMYLYGFDDAFINDFQSKVDGLTLTEAQRLVSTYFPQDNLQFVLIGNADKI
FT                   APIAAEYGDVTRIGIKAVGFGG"
     atgaaaacct taactcatct atcaaaaagc tcgaacagac ttattgctgc catctttatc        60
     acaggcatga gcttgtccgg ttgtgccact cagactgtat cgacaccggt agataccggt       120
     agctttagta tgccggccta tgagcagttt aagcttgaaa atggtttaac tgtctattta       180
     atgccgcaaa aagaggtacc actaatcacg gtaaacgcgg tggttcgcgc cggggccgtg       240
     aatgatacga cctcgggtgt cgctggaatg acggctcaaa gcttactctt gggagccgat       300
     ggtaagtcga aaagtgaaat cgaacagatg gtcgattttc tcggtgcgtc tatctatgcc       360
     gatgcgggaa aagaggggag ctacataggt gctgatttta tggctaaaga tagcgataag       420
     atcttgcccc tgatccagag tttactcctg tcaccggatt tcgatgccgc cgagttcgat       480
     aagctacgtc aacgggagat tgccggacta tctcaggcga aagagagccc tcgcgccgtt       540
     atcagccgct acttcgacaa actaatttat ggttcacatc catatggtaa cgcctcatcg       600
     ggtaatagtg tctcattagc tgagctcaat atctcgcaat taagagcgtt tcatcagagt       660
     tattatcagc cagctaacac agcgataagt gttgtcggtg acttcgacgt taagcagatg       720
     aaatctacta tgaagcagtt gtttggtcgt tggaagaata gtgaagaggt tgtcacacct       780
     gcactaaaat ccaatcaacc cgagctgaca aaaagtcagg tactgttagt cgataagggt       840
     gatgcaatcg aaactacctt ccttatcggc ggtaaaggga tctcccgtga caacccggat       900
     tatgtcggct tgaaggtgat taataccatc cttggaggac gctttacgtc atggttgaat       960
     gatgaactaa gggttaatgc cggattgacc tatggagctc gttccgggtt tattccctat      1020
     tctgaaggcg gcatattcag gatcagcacc ttcactaaaa ctgagacgac caaagagacc      1080
     atagatctgg ccttgaaaac ctatgcacga ctctgggaga caggagtcga ccagaagaca      1140
     ttagattcag ctaaggccta tgtgaagggg cagttcccgc caaagtttga aaccagtggt      1200
     aagcttgcag ggctgttatc tgacatgtac ctgtatggtt tcgatgatgc gtttatcaat      1260
     gactttcaat cgaaagttga tggcctgact ctgaccgagg cccagaggtt ggttagcacc      1320
     tacttccctc aggataacct gcaatttgtg cttattggta acgcagacaa gatagcgccg      1380
     attgctgccg agtatggtga tgtgacccgg attgggatta aagctgtagg atttggagga      1440
     taa                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page