(data stored in ACNUC7421 zone)

EMBL: CP000821.PE263

CP000821.PE263       Location/Qualifiers
FT   CDS_pept        298019..298585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_3442 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34876"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV3"
FT                   /protein_id="ABV34876.1"
FT                   /translation="MVMSQVLAANKHRDIHQDDDTVDWCHIQESLKILLLAMAQIELSL
FT                   TDGEHNVTELGSLFTNMAKHLDEVNAFLSQQSDTPDEIISHGTDLAASINEGVVAFQFY
FT                   DRVSQRLQHVIMGLALMEEVLNSKQLRISPDAWRKLQEEIQESYSLDCERKMFDLVLQG
FT                   TSVHEALKLYRDENQSPKEDDIELF"
     atggttatga gtcaggtatt ggcagctaat aaacatagag atattcatca ggatgatgac        60
     accgtggatt ggtgtcatat tcaggaaagt ctcaagatct tactgttagc tatggcgcaa       120
     attgagttgt cattgaccga tggcgagcat aacgtcactg agttaggctc gctatttacc       180
     aacatggcta aacacttgga tgaagtgaat gcttttctct ctcaacagtc agacaccccg       240
     gatgagatta tctctcatgg cacagatctg gccgcttcga ttaatgaggg ggtggttgct       300
     tttcagtttt atgaccgggt ctcccagcgt ctgcagcatg tcattatggg gctggcgctg       360
     atggaagagg tattgaacag taagcaatta cgaatatcgc cagatgcgtg gagaaagcta       420
     caggaagaga tacaggagag ttattcactt gattgtgaga gaaaaatgtt cgatcttgta       480
     ctgcaaggaa catcagttca cgaggcatta aaactctatc gagatgaaaa tcagtcacct       540
     aaagaagatg atatcgagct gttttaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page