(data stored in ACNUC7421 zone)

EMBL: CP000821.PE264

CP000821.PE264       Location/Qualifiers
FT   CDS_pept        298542..299078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34877"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV4"
FT                   /protein_id="ABV34877.1"
FT                   /translation="MKISHLKKMISSCFKYSLLFLIFTPSLSLADKASFSDFCLSMAGQ
FT                   WQGTSAKLKQKPLQTYVSAICSADRRQLIFSVSRSAKHPFSETWWFRERGESTFLIYYD
FT                   GVDKDKSQSFSLYQQNESFSLLGEGKLNKRPALIQLRFEPKESGWLWLQNVQYLDDDTD
FT                   RYLFYRGIEMMPLER"
     atgaaaatca gtcacctaaa gaagatgata tcgagctgtt ttaaatacag cttattattt        60
     cttattttta ccccctcttt atccctggcc gataaggcta gcttcagtga tttctgtctg       120
     tcgatggcgg gtcaatggca gggaacctcg gctaagctaa aacagaagcc actccagacc       180
     tatgtcagcg caatatgttc ggcagacaga cgacagctaa tattttcagt cagccgtagc       240
     gcaaagcatc ctttcagtga gacctggtgg ttcagggagc ggggagagtc cacttttctt       300
     atctactacg atggggtgga taaagataag agtcagagct ttagtctgta tcaacaaaac       360
     gagagttttt cactgctggg agaggggaag ttaaataaac gaccggcctt gattcaacta       420
     aggtttgagc caaaagagag cggttggctc tggttgcaga atgtgcagta cctggatgat       480
     gataccgatc gttacctctt ctatcgcggc atcgagatga tgccgctaga gcgttag          537
//

If you have problems or comments...

PBIL Back to PBIL home page