(data stored in ACNUC7421 zone)

EMBL: CP000821.PE267

CP000821.PE267       Location/Qualifiers
FT   CDS_pept        complement(300775..301671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0267"
FT                   /product="conserved hypothetical pyruvate formate lyase
FT                   activating enzyme"
FT                   /note="KEGG: ppr:PBPRA2007 hypothetical pyruvate formate
FT                   lyase activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34880"
FT                   /db_xref="GOA:A8FPV7"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV7"
FT                   /protein_id="ABV34880.1"
FT                   /translation="MNNRLSTLSKTASVSQIINFSCVDGPGSRLVVFLQGCNYNCKNCH
FT                   NPHTIDMCDSCGDCIAHCPTQALSMESIDGKDAIRWNSDLCSGCDTCLAVCPKQSTPKT
FT                   QEYNVTQMLEMIRKQASFISGITISGGEATLQLHFIIALFKAIKSSDDLQHLSCMLDSN
FT                   GSLNETAWQKLLPYMDGAMIDLKAWQQETHRYITGRDNHRVLRSINLLNLHNKLYEVRL
FT                   LQIPEVTDFESEIDALAGFLTQLPPSTRIKLNAFQHHGVTGEALAWRVCSEANIERLAS
FT                   QLTERGVKQPILPSVYL"
     atgaacaatc gcctgtctac gctaagtaaa acggcgtcag taagccagat tatcaatttc        60
     tcgtgtgtcg atgggcctgg aagcaggctc gttgtttttt tgcaagggtg taactacaac       120
     tgcaagaact gccacaatcc tcatacaatc gacatgtgtg atagttgtgg cgactgtatt       180
     gcccactgtc ccactcaggc gctgagcatg gagtccatag atggtaaaga tgccatccgg       240
     tggaatagcg atttatgctc cgggtgcgat acctgcttag ccgtatgccc caaacaatcg       300
     actcctaaga cccaagagta taacgtcacc cagatgctgg agatgatccg caaacaagcg       360
     tccttcatct caggaataac catttccggc ggtgaagcga cgctacagct tcatttcatt       420
     attgccctgt ttaaggccat caagtcgagt gatgatctgc aacacctatc ttgcatgctt       480
     gatagcaatg gcagcttgaa tgaaaccgcc tggcaaaagc tcctgcccta tatggatggt       540
     gccatgatag atctaaaagc ctggcaacag gagacccaca gatacataac gggtcgggat       600
     aaccacaggg tattgaggtc aattaaccta ttaaacctgc acaataagtt atacgaagta       660
     cgattattac agatacctga agtgactgat tttgagtctg aaattgatgc gttggcaggt       720
     ttcctgactc agctcccccc ctcgacacga atcaagctca atgcgtttca acaccatggt       780
     gtgacgggag aggcgttagc atggcgagtc tgctctgaag cgaatattga aagactggca       840
     agccaactga cagagcgagg agttaagcaa cctatcttac ccagtgttta tctctaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page