(data stored in ACNUC7421 zone)

EMBL: CP000821.PE268

CP000821.PE268       Location/Qualifiers
FT   CDS_pept        complement(301643..303196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO2407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34881"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV8"
FT                   /protein_id="ABV34881.1"
FT                   /translation="MTLQKKFAQIVSDPRLSPKQKSNYLALEADASLPYLTISKAVTQA
FT                   MSTGIICDMFEGNAPFKPRYVLPDYAKFLQQGSEYLELQAPQDLDEALNALTIIYHHVP
FT                   SVTNIPVYLGQLDEILMPFVDGLDEDVVYRKLKLFWIMLDRTLPDAFMHVNIGPSDNIV
FT                   CRTILRVDAELKQVAPNLTFMYDPDITPDALLQVAASNICECSKPHIANYPIHKSAYDK
FT                   QGFGIVSCYNSLPLAGGANTLVRLNLKEVALKADNIDNFFAHTLPHYCQLTYELIEARS
FT                   KYLHEESHFFDSFLVKEALIEEQRFAPMFGIYGMAEAVNILLGNPELCETASEKPSKHY
FT                   GHSKAANELGHRISAALDSIVKSTPVTYGYHGRALLHSQGGISLDIDVTPGVRIPYGTE
FT                   PDPISHVRALAEHHQYYTSGISDILTIDETVKSNPEAMYQLCKGTLSLGFREFTANVAS
FT                   NDLIRVTGYMIKLSDIADFKRQGSRTNTTGLGAEAAANTGILNRKPRVTSHEQSPVYAK
FT                   "
     atgaccttgc agaaaaaatt tgcgcaaatc gttagcgacc caaggctgtc cccaaagcaa        60
     aaatcgaact acttagcctt agaggccgat gcaagtctac cttatctcac tatttcaaag       120
     gccgttactc aggccatgag cacaggtatt atctgcgata tgtttgaagg caatgcgcca       180
     ttcaaacccc gttacgtttt gcccgactac gctaaatttt tgcaacaagg atcggaatat       240
     ctggaactgc aagcccctca ggatctggat gaagcactca acgcattaac catcatctat       300
     caccacgttc cctctgtaac caatatcccg gtttatctgg ggcagttgga tgagatcctg       360
     atgcctttcg tcgatggact ggatgaagat gtcgtctacc gaaaattaaa actcttctgg       420
     atcatgctcg accgtacgct tcccgatgcc tttatgcatg taaacatagg gccgagcgac       480
     aatatcgtct gtcgaaccat tctaagagtg gatgctgaac ttaagcaggt cgcaccgaac       540
     ctgaccttta tgtacgatcc cgatattaca ccggatgcgt tattgcaagt tgcagcgagc       600
     aacatctgtg aatgcagcaa gccgcatatc gccaactacc ctattcacaa aagcgcttat       660
     gacaaacagg ggttcgggat tgtaagctgt tataactcat tacctttagc gggtggcgcc       720
     aataccttag tgcgcctcaa ccttaaagag gtcgcgctta aagccgacaa catcgataac       780
     ttctttgctc ataccttgcc ccattattgc cagctcactt atgaactgat cgaggctcgt       840
     agcaaatacc tacacgaaga atcacacttc ttcgatagtt ttctggtcaa agaggcacta       900
     attgaagagc agaggtttgc acctatgttc ggtatttacg gcatggcgga agcggttaac       960
     atattactgg gtaacccgga attatgtgag acggcatctg agaagccgag taagcactac      1020
     ggtcacagca aggctgcgaa tgagttaggc catcgaatct cagccgcgct ggatagcata      1080
     gtaaaatcga cacctgtcac ctatggctac catgggcgag cgcttctgca ttctcagggg      1140
     ggaataagcc tggatatcga cgtgactccc ggtgtgcgga tcccttatgg taccgagccc      1200
     gatcctatat cccatgtgcg ggcattagcc gaacatcacc agtattatac ttccggcatc      1260
     agcgatattt tgactattga tgagacggta aaatcgaacc ctgaagccat gtaccaactg      1320
     tgcaaaggga cgctgagcct aggttttcgt gagtttaccg cgaatgtcgc ctctaacgac      1380
     ttaatccggg tcacaggcta catgattaaa ttatctgata tcgctgactt taaacggcaa      1440
     ggctcccgta ccaataccac aggtttagga gcggaagcgg cggccaatac cgggatttta      1500
     aatcgcaaac caagagtcac gagtcatgaa caatcgcctg tctacgctaa gtaa            1554
//

If you have problems or comments...

PBIL Back to PBIL home page