(data stored in ACNUC7421 zone)

EMBL: CP000821.PE271

CP000821.PE271       Location/Qualifiers
FT   CDS_pept        307242..308222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0271"
FT                   /product="alcohol dehydrogenase GroES domain protein"
FT                   /note="KEGG: slo:Shew_3572 alcohol dehydrogenase GroES
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34884"
FT                   /db_xref="GOA:A8FPW1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW1"
FT                   /protein_id="ABV34884.1"
FT                   /translation="MFKALVLTQEDRVTLANICQLPETDLPEGEVLVDVACSSLNYKDG
FT                   LAVTGTGRIIRNFPMVPGIDFAGVVSESADPRYKAGDRVILTGWGVGENHWGGMAEKAR
FT                   VNADWLVPMPEACSADKAMMIGTAGLTAMLCVQALQNANIKPESGDILVTGASGGVGSV
FT                   AVTLLSRLGYKVVASTGRADENADLLRSLGASEVMERSELEQDARPLEKQRWAGIVDTV
FT                   GNKVLATALAQMQYGGAAAICGLAGGFALPTTVMPFILRGVSLLGVDSVSCPFEKRQAA
FT                   WEQVLELLPDSYYQQAGQTISLDQVPEFADKIVKGQVTGRVLVKL"
     atgttcaaag cactggtatt aacacaagaa gatagggtta cgttagctaa tatttgtcaa        60
     cttccagaga ctgacttgcc tgagggtgag gtgttagtcg atgtagcttg ttcatcgctg       120
     aactataaag atggtttggc tgtgaccgga accggacgca ttatccgtaa tttccctatg       180
     gtgccgggta tcgatttcgc cggtgttgtc agtgagtctg ccgacccacg ctataaggcg       240
     ggtgatagag ttatcctgac cggatggggc gtaggcgaaa atcactgggg tggcatggct       300
     gaaaaggcgc gcgtcaacgc tgattggtta gtgcctatgc ctgaagcttg ttctgccgac       360
     aaagccatga tgataggtac tgccggtctt acggcaatgc tttgcgtgca ggcacttcaa       420
     aatgccaata ttaaacctga gtcgggtgat atcttagtga cgggtgccag tggtggcgta       480
     ggttcagtcg ccgtcaccct gttatcacgc ctgggttata aggtcgtggc cagtaccgga       540
     cgcgccgatg agaatgccga tcttcttcgc tctcttggtg ccagtgaagt gatggagcgt       600
     agtgagctcg agcaagatgc aagaccactg gagaagcagc gctgggcagg tatcgtcgat       660
     accgtcggta ataaagtatt agcgacagca ttggcgcaga tgcagtatgg cggcgcggcg       720
     gcgatatgtg gtctggctgg tggatttgca ctgccaacta ctgtgatgcc atttattcta       780
     cgtggtgtca gcttgttagg agtcgactcc gtttcatgtc catttgaaaa gcgccaggcg       840
     gcatgggagc aagtgcttga gctgttaccc gacagctact atcaacaagc gggtcaaacc       900
     attagcctgg atcaggttcc tgagttcgcc gataagatag ttaaaggaca agtaaccggt       960
     cgagtactcg ttaagcttta g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page