(data stored in ACNUC7421 zone)

EMBL: CP000821.PE276

CP000821.PE276       Location/Qualifiers
FT   CDS_pept        complement(312872..313735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0276"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="KEGG: sfr:Sfri_3892 transcriptional regulator, LysR
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34889"
FT                   /db_xref="GOA:A8FPW6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW6"
FT                   /protein_id="ABV34889.1"
FT                   /translation="MLKSELLEGFIAVAECGNLSKAAEKICRTQSTLSLQIKKLEESVG
FT                   QSLLLRDNKGVTLTEPGETLLNYAYKMMQLNSQALDELKECKNKEVIRLGVPTDYINRY
FT                   LSSSLLEFIREFTCIELVIDTDVSGNLYKRLHQGEFDVIVATHWQTPAPGHGELLFERR
FT                   FLWATAKGGNAHKRNTIPMALYPENCPIRAQVFANHQISMRQINVLLSTPSPNALCMAV
FT                   ENDLAIAPIAEFRINDKMEVLDPIEHNLPPLPVFNESLYLNPDTQTKATKQLTTLLKAH
FT                   TEKYQQ"
     atgcttaaga gtgaattatt agaaggtttt atcgccgtcg ccgaatgcgg aaacttgtct        60
     aaggctgcgg agaagatctg tcgaactcaa tcaaccctta gcttacagat taaaaagctc       120
     gaggagagtg tgggccaatc cctgctactg agagataata aaggtgtcac gctgacagag       180
     ccgggtgaaa ccctgctcaa ctatgcttat aagatgatgc aactaaactc tcaggcactc       240
     gatgagctaa aggagtgtaa aaacaaagaa gtcattcgct taggtgttcc taccgattac       300
     attaaccgtt atctcagtag tagcctgctt gagtttattc gcgaattcac ctgcatcgag       360
     ttggtgatcg atactgacgt cagtggcaac ctttataaac gtctgcatca gggggagttc       420
     gatgttatcg tcgcgactca ctggcaaacg ccagcaccag gacatggcga actgctattt       480
     gagcgccgct ttctctgggc tacagccaag ggcggtaatg cccacaagcg caatactatc       540
     ccaatggcgc tctaccctga aaactgtcct attcgagccc aggtctttgc caaccatcag       600
     atatcgatgc gtcagatcaa tgttctgctt tccactccct cgccaaatgc tctatgcatg       660
     gcggttgaga acgatttagc aatagcgcct atcgcagagt ttcgcatcaa cgacaagatg       720
     gaagttctcg atcctatcga gcataacctg cccccattgc ctgtatttaa tgagtcgctg       780
     tatctcaatc ctgacacaca aactaaagcg acgaaacagt taaccacact gcttaaggct       840
     cacacagaaa agtatcagca ataa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page