(data stored in ACNUC7421 zone)

EMBL: CP000821.PE278

CP000821.PE278       Location/Qualifiers
FT   CDS_pept        complement(314510..315877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0278"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: sbl:Sbal_0260 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34891"
FT                   /db_xref="GOA:A8FPW8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW8"
FT                   /protein_id="ABV34891.1"
FT                   /translation="MIKDRLPNRIFIKLLLGFWLCSSLIIAIVGLLPLLQQSHDRAPLP
FT                   PHLEKLLERYAERIIDNPEIIQNNQFRRLSHRRDFQGKPIRFYLVNDQGRVINTEKVSR
FT                   GMRRFMLMAEETSKPISHQFKDELLFGPYNFAVSGKQYSLYGRFNDRHPRPWFFFFAEN
FT                   KLLTLTLAIGLSGLICGLLAWHLGKPLRTLRLSADALANGDLTNRVDYATTKRKDEIGQ
FT                   LAQAFNGMADSVENMVNSQQRLISDISHELRTPLTRLQLALALARKKGQESAETERIGY
FT                   EAEQLEKMISELLELSKVKLNAHDHKRHLGLAETLGQVLDDAEFEAEQQQKELIIKIDE
FT                   EIELPLYPKPLSRAIENLLRNAIRYSQSSVSIKAHKAMNIVTIEITDDGPGIDNEQDLL
FT                   AIFKPFYRPQSARERESGGWGLGLAITEAAVMAHQGKITASNLAPHGLNVTIELPS"
     atgatcaaag acagactccc taatcgaata tttatcaagt tactgctcgg tttctggctg        60
     tgtagctccc taatcatcgc catcgttggc ctgctgcctc tgttgcagca aagccacgat       120
     cgcgccccat tgcctcctca ccttgaaaag ctactcgagc gatatgcaga gcggatcata       180
     gataatccgg agatcattca aaacaatcaa ttcaggcgtc ttagtcatcg tcgtgatttt       240
     caggggaaac cgattcgatt ttatctggta aacgatcaag gaagggtcat caataccgaa       300
     aaagtttcac gaggtatgcg gcgattcatg cttatggcag aggaaaccag taaaccgatc       360
     agtcatcaat ttaaggatga gctgctcttt ggcccctaca attttgcagt atcaggaaag       420
     caatattctt tgtatggtcg atttaatgat cgtcatcctc gtccctggtt tttcttcttc       480
     gctgaaaaca agctgctcac cttaacactg gcgatcgggt tatcagggct aatttgtgga       540
     ctactcgctt ggcacttagg taaaccactt cgaacactga gactcagtgc cgatgcactt       600
     gccaatgggg atctaaccaa tcgtgtcgac tatgcaacca ctaagcgaaa agatgagata       660
     ggtcaattgg ctcaagcctt taacggtatg gccgactctg ttgaaaatat ggttaatagc       720
     caacaaagac tcatcagtga catctcacat gaactccgta caccacttac ccgattgcag       780
     ctcgcactag ccttagctcg taagaagggg caagagtctg cagaaaccga gcgtattggc       840
     tacgaggctg agcaattaga gaagatgatc tcagagctat tagagctatc taaagtcaaa       900
     ctcaatgctc atgatcacaa aagacacctc ggtttagcgg agacattagg gcaggtactc       960
     gacgatgccg agtttgaggc agaacagcag caaaaggagt taataattaa gatagatgag      1020
     gagatagagt tacctctcta ccctaagcct ctgtcccgcg ctattgaaaa cttgttacgt      1080
     aatgcgattc gatattctca atcttctgtc tcaatcaaag cccacaaggc aatgaacatc      1140
     gtgacaattg agataaccga cgacggtccg ggcatagata atgaacaaga tctgctggca      1200
     atcttcaaac ctttctatcg tccacaatcg gcacgagaga gagagtccgg aggctggggg      1260
     ttaggacttg cgattaccga ggcagctgta atggctcatc agggcaagat tactgcatct      1320
     aatctcgccc cccatgggct aaatgtgact attgagctac cgagttaa                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page