(data stored in ACNUC7421 zone)

EMBL: CP000821.PE28

CP000821.PE28        Location/Qualifiers
FT   CDS_pept        complement(34180..34488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0028"
FT                   /product="regulatory protein, ArsR"
FT                   /note="KEGG: shw:Sputw3181_0018 regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34641"
FT                   /db_xref="GOA:A8FP68"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP68"
FT                   /protein_id="ABV34641.1"
FT                   /translation="MQKEIDVDAMVTNAESAAKWLKAIANPYRLMILCLLLENEYSVTE
FT                   LNETVPLSQSALSQHLAVLRAQDLVSTRKSSQVVYYKLKNEQVTKIISILHSQYCAN"
     atgcaaaaag aaattgatgt agatgcaatg gtaaccaatg ctgagagcgc agcgaaatgg        60
     ctaaaagcaa tcgccaatcc ctaccgcttg atgattttgt gcttattact cgaaaatgag       120
     tatagcgtta ccgagttaaa tgaaacggtt cctctaagcc agtctgcact ttcgcagcac       180
     cttgccgtgc tccgtgcaca ggatttggtg tcgacaagaa aaagctctca ggttgtctac       240
     tacaagctca agaatgagca ggtaaccaag atcatctcaa ttttacacag ccagtactgc       300
     gcaaattaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page