(data stored in ACNUC7421 zone)

EMBL: CP000821.PE280

CP000821.PE280       Location/Qualifiers
FT   CDS_pept        316789..317295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0280"
FT                   /product="protein of unknown function, Spy-related"
FT                   /note="KEGG: she:Shewmr4_0253 protein of unknown function,
FT                   Spy-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34893"
FT                   /db_xref="GOA:A8FPX0"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX0"
FT                   /protein_id="ABV34893.1"
FT                   /translation="MKANTLKAGLLAIVAGTALLTTSVYAEQQTGCQDSGYHMKGDRMG
FT                   HHNGGMKSAMKKMFRGLDLTDEQRTEIKTLMKAQKDSMQGSRPTSDERQAHKTEMLALI
FT                   TADSFDESQVKLLMQQKHEKRQDKAVGMLKVQNEIYKLLTPEQQVKFKENFEKGHSRHE
FT                   RKGER"
     atgaaagcaa atacattgaa agcagggcta cttgccatcg tggccggtac cgcgttattg        60
     actacaagcg tttatgcaga acagcagact ggatgccaag atagtggcta ccatatgaaa       120
     ggtgacagaa tggggcatca taatggtggt atgaagagtg ctatgaagaa gatgttcaga       180
     ggcttagatc tgaccgatga gcagcgcacc gaaattaaaa cattgatgaa agcacagaaa       240
     gattcaatgc agggcagccg tccaacgagt gatgaacgcc aggcacataa aacagagatg       300
     cttgccttga tcactgcaga tagtttcgat gaatctcaag taaaactact catgcagcaa       360
     aagcatgaga agcgtcaaga taaagccgta ggtatgctta aagtgcagaa tgagatatat       420
     aagctactga ctcctgagca gcaagttaag tttaaggaga acttcgaaaa ggggcattct       480
     cgtcacgaac gtaaaggtga gcgatag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page