(data stored in ACNUC7421 zone)

EMBL: CP000821.PE283

CP000821.PE283       Location/Qualifiers
FT   CDS_pept        complement(333272..334312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0283"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="KEGG: shw:Sputw3181_0222 signal transduction
FT                   histidine kinase, nitrogen specific, NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34896"
FT                   /db_xref="GOA:A8FPX3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX3"
FT                   /protein_id="ABV34896.1"
FT                   /translation="MDIKHLFNNLVTAVMVIDVDLKLCYANAAAEQLLGVGSHRLTEHV
FT                   LSDSFQILGVSTDLLSKAIRENQGLTVNTAPLVTLDNQHHTVDITLTPLEQEQGLGLLE
FT                   LRQVDQQRRIHQQLTLDAQQQAAQYLVRNLAHEIKNPLGGLRGAAQLLSRELHDPQLNE
FT                   FTDLIIEQADRLRNLVDRLLGPQRPTQHSLHNIHEVVQKVLNLVNMALPPNITLKQDYD
FT                   PSIPDIQMDPEQLQQAVLNIVQNAIQALDTAGGEILIRTRTQHQVTIGTLRHKLVLALS
FT                   IIDNGPGIKPELLDTLFYPMVTGRDNGSGLGLSIAHNFARLHGGRIDCHSKLGRTEFTI
FT                   LLPIKN"
     atggatataa aacacctgtt caataacctt gtaacagcag tcatggtcat cgatgttgat        60
     ctcaagcttt gctatgccaa cgcagcggct gagcagctct taggtgtggg aagccatcgc       120
     ttaaccgaac atgttctatc agacagtttt caaatccttg gcgtaagtac cgatttattg       180
     agtaaggcta tcagagaaaa ccaagggctc acggttaata ccgcccccct ggtaacattg       240
     gataaccaac atcataccgt agacataacg ctcacccctt tagagcagga acagggctta       300
     gggctgttag aactcaggca ggtagatcaa cagaggcgta ttcatcaaca actgacttta       360
     gatgcgcaac aacaagccgc tcaatacttg gtgagaaacc tggcgcatga aatcaaaaac       420
     cctttgggtg gccttcgtgg tgcagcgcaa ctgctctctc gtgaactaca tgatccgcag       480
     ttgaatgagt ttaccgatct tattatcgag caagccgacc gactacgaaa tctggtggac       540
     agattactcg gcccccagag accaacccaa catagcctgc ataatattca tgaagtcgtt       600
     caaaaagtac ttaaccttgt gaacatggcc cttccaccga acatcacgct gaagcaagat       660
     tacgaccctt ccatacccga tattcaaatg gatcctgaac agctgcaaca agccgtactc       720
     aacatagttc aaaatgcaat tcaggcactc gacaccgcag gcggggagat attgataagg       780
     acgcgcaccc agcaccaagt caccatcggc actttaagac acaaacttgt attagcctta       840
     tccatcatag acaacggccc aggtatcaaa cctgaactat tagacacact tttttaccct       900
     atggtaacag gtcgtgataa cggttcagga cttggtttat cgattgcgca taactttgct       960
     cggctacatg gcggtagaat tgattgccat tccaagcttg ggaggactga attcacaatc      1020
     ttacttccca taaaaaacta a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page