(data stored in ACNUC7421 zone)

EMBL: CP000821.PE284

CP000821.PE284       Location/Qualifiers
FT   CDS_pept        complement(334444..334980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34897"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX4"
FT                   /protein_id="ABV34897.1"
FT                   /translation="MRLALIFSLLLFTVISHAAVYKWVDKDGKIHYSDKPIQNSEVVEF
FT                   KSNTQNQITIQAPKNSASDTEEQTVPSTQYKMSILTPKEDETIRDNNGDITIMATITPD
FT                   LKPKHLLVILMDDKVIGPAQENPIFSLKNIDRGEHSFVIKAVAQNGKQLATTSPRKIFL
FT                   HRAIINSKAKVTPFN"
     atgcgtttag ctcttatttt cagtcttttg ctttttacag tgatctccca tgcggctgtt        60
     tataaatggg tcgacaaaga tggcaagatc cactattcag ataagccaat acagaattca       120
     gaagtcgtcg aatttaaaag taacactcaa aaccagatca caatccaggc tcccaaaaat       180
     tcagcttctg atacagaaga gcaaacagta ccttctactc agtataaaat gagtattcta       240
     acgccaaaag aagatgaaac cattcgagat aataatggcg atatcaccat aatggcgaca       300
     ataacacccg atctgaaacc caagcatcta ctcgtcattt tgatggacga caaggtgatt       360
     ggccccgcgc aagaaaaccc tatctttagt cttaaaaata ttgaccgtgg cgaacactct       420
     ttcgtcatta aagcggtagc ccaaaatggc aaacaacttg caacgacttc accaaggaag       480
     atctttctcc accgagccat aataaacagt aaggcaaaag tcactccttt taattag          537
//

If you have problems or comments...

PBIL Back to PBIL home page