(data stored in ACNUC7421 zone)

EMBL: CP000821.PE285

CP000821.PE285       Location/Qualifiers
FT   CDS_pept        complement(335181..335858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0285"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="KEGG: sbl:Sbal_0270 ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34898"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX5"
FT                   /protein_id="ABV34898.1"
FT                   /translation="MNILMVLTSHDKLGDTGLKTGFWLEEFASPYYRFKDKNFNITLAS
FT                   PAGGQPPLDPTSEQADFQTAATDRFNQDSETQQQLATTLTLASIKAEDYDAIFYPGGHG
FT                   PLWDLTNDAHSIALIQAFYQANKPVGLVCHAPGALKNVKSADGTPLVQGKRVTGFTNTE
FT                   EAAVQLTDVVPFLVEEMMQENGALYSKGDDWASYLAVDGNLVTGQNPASSEVVADEMIK
FT                   QLG"
     atgaacatat tgatggtact gacttctcac gacaagcttg gcgatacagg attaaaaaca        60
     ggtttttggt tagaggaatt tgcgagtcct tactaccgtt ttaaagacaa gaacttcaac       120
     atcactttag catcgccagc cggcggacag ccgccactgg atccaaccag tgagcaagca       180
     gactttcaaa ctgcagcaac agaccgcttc aatcaagaca gtgaaaccca acagcagtta       240
     gctaccactc ttactctggc cagcattaag gccgaagatt atgatgccat cttctatcct       300
     ggcggccacg gtccactgtg ggacctgacc aacgacgctc actcaattgc attgatccaa       360
     gccttttatc aggcgaataa gcctgtcggt ctggtctgtc atgctccggg ggctcttaaa       420
     aatgtaaaat cagccgatgg cacgccattg gtacaaggta agcgtgttac tggttttacc       480
     aacaccgaag aggctgccgt tcaattaacg gatgtcgtac catttttagt cgaagagatg       540
     atgcaagaaa acggcgcttt gtatagtaag ggcgatgact gggcaagtta ccttgctgtt       600
     gatggaaatc tggtgactgg gcaaaatcct gcgtcatctg aagtagttgc tgacgagatg       660
     attaaacagc taggttaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page