(data stored in ACNUC7421 zone)

EMBL: CP000821.PE288

CP000821.PE288       Location/Qualifiers
FT   CDS_pept        complement(337975..338292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34901"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX8"
FT                   /protein_id="ABV34901.1"
FT                   /translation="MNNKIKATLVSLSLLFTSTSYAAMSDIAVCNDCSAQEVKTLIDNE
FT                   TSANIYVVDFVNRTAQKFTSGDENGSQPIAIAMSISELNTINQRYEYRKTHLRALNPSS
FT                   K"
     atgaacaata aaatcaaagc aaccttagtc tcattgtctc tactcttcac atccacaagc        60
     tacgctgcca tgtctgatat tgctgtctgc aatgactgtt cggctcagga agttaaaaca       120
     cttattgata atgaaacatc tgcaaatatt tatgtggtgg acttcgtaaa ccgcactgca       180
     caaaaattta cctcaggcga tgaaaatggc tctcagccaa ttgcaatagc gatgtcaatt       240
     agtgagctta acaccattaa tcaacgctac gagtaccgta aaacacattt gcgcgccctt       300
     aacccaagtt caaaataa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page