(data stored in ACNUC7421 zone)

EMBL: CP000821.PE290

CP000821.PE290       Location/Qualifiers
FT   CDS_pept        complement(339691..342486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0290"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: saz:Sama_0067 signal transduction histidine
FT                   kinase-like protein protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34903"
FT                   /db_xref="GOA:A8FPY0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY0"
FT                   /protein_id="ABV34903.1"
FT                   /translation="MAPSSYRHSIGFRLNLSTLIIGFIICVILSGYFIQETRERLKVQA
FT                   HHELTQITDSLKLALETNSQTSNMIRVVGVLSTYPNITRLTVIKASDLSISADSLVQNN
FT                   GKRANLVFSNTIMKLINNPAKSSQRDQGILIDNSLHQSVKIHLVDPQANRLKPYIIYLE
FT                   YNKQALERILQQARNHLMLIVIGGLILLLLINIFIQRVVVLKPLSKMTQQLLNQDNSEQ
FT                   IPEPLQVSTNDEFSILANSYNGSIHKQLLQKAEVEKSHRYIKNMASALPVHLLYVDIDK
FT                   KIQFINQYSLQWLAKPMEEVLTQTCRQVLPSQLFSLIERPIETALQGDSITLDAEFFHK
FT                   NMSLFFHITHIPDIDNEGRIKGIFICIEDRTQTRDNEKKIEKYAHQLEMNNLALDDARE
FT                   TAEAAAQSKSEFLACMSHEIRTPMNGVLGMLTLLERTALDQSQRNHLDTAQGSARNLLG
FT                   LINDILDFSKIESGKFPIESVNFSLTNLLNETIRPLAIRAQEKGIELVSDITDITSQSF
FT                   KGDPTRISQVLTNLIGNAIKFTEKGSITVYVKQNDDIEPRLNFSVEDTGIGLASNQLEK
FT                   LFQPFTQADSSTTRHFGGTGLGLSIAKRLTELMGGSISVVSTEGKGSKFSFNVRVEIAS
FT                   KDDLYATDLNSLPILFFSRGTRADQVLGKTLNLLNASLKVVKAARLANFKPASISDTYR
FT                   PKLTIIHLPAGQEAIETELAKLASNTDLPDTPILLFIAAIDESIMTQYLNEQIFTYLCN
FT                   PLHLEQLLIALKQIDQTAPHLVQRLAPQTQRDWDLKSYFEDRLPKLLLVEDNKTNQMVA
FT                   QGIIAEFGLEIDIASDGEQAIEILKDSITSPYQLIFMDCQMPRLDGYQTTQMIRAGYTG
FT                   HQYKHIPIIAMTANAMVGDRERCLQAGMNDYISKPLDPDDIKQALLSTLAGHDTESEMR
FT                   N"
     atggcaccga gcagctatcg acatagcata gggttcaggc tcaatctcag cacgctgatc        60
     ataggattta ttatctgcgt gatcttgagt ggttacttta ttcaggagac acgggaacga       120
     cttaaagttc aagcccatca tgaattaacc caaataacgg actcattaaa gcttgccctt       180
     gaaacgaact cacagaccag caatatgatc agagtggttg gggtgttatc cacctaccca       240
     aacatcacac gccttaccgt catcaaggcc tcagatctca gcattagcgc cgatagctta       300
     gtacaaaaca atggtaaaag agccaatctg gtattttcca ataccattat gaagctcatc       360
     aataatcccg ctaagagtag tcaaagagat caggggatct tgatagataa cagcctacat       420
     cagtctgtaa aaatccacct ggtagatccc caagcaaacc ggttaaagcc ctacattatc       480
     tacctcgaat ataacaagca agcgctcgaa agaatcttac agcaagccag aaatcactta       540
     atgttgatcg tgattggcgg gttaatttta ctcttgttga ttaatatttt tattcaacga       600
     gtcgtcgtgt taaagccgct ttcaaagatg acgcaacagc tactgaatca agataacagc       660
     gagcaaattc ccgaacctct gcaagtgtct actaatgatg aatttagcat tctggcaaat       720
     agttataatg gttcaatcca taaacaacta ctgcaaaaag ctgaggtcga aaaatcacac       780
     agatatatca agaacatggc tagcgcgctt ccggtgcatt tactgtatgt agatatcgac       840
     aaaaaaattc agtttatcaa tcaatatagt ctgcagtggt tagccaaacc gatggaggag       900
     gtgttaacgc aaacttgccg acaggtactc cccagtcaat tattcagttt aatcgagcgg       960
     cccattgaaa ctgcgttaca aggtgattca atcaccttag acgctgagtt ttttcacaaa      1020
     aatatgagtc tgttttttca tatcacccat ataccggata tcgataacga agggagaata      1080
     aaaggaatat ttatctgtat tgaggataga actcagacaa gagataacga aaagaagatt      1140
     gagaaatatg cccaccagct tgagatgaac aacctggctt tagatgatgc ccgtgaaacc      1200
     gcagaagcgg ctgcacagtc taaatcggag tttctcgcct gtatgagtca tgagatccgc      1260
     acaccgatga atggggtttt aggtatgctc accctgttag agcgtacagc cctggatcaa      1320
     agtcaacgta atcacttaga taccgcccaa ggcagcgcaa gaaacctgct aggcttaatc      1380
     aacgatattc ttgatttttc aaagattgaa tctggaaaat ttcccataga gtccgttaat      1440
     tttagcttga ccaatctact caatgaaact attcgccctc tagccattcg cgcacaagag      1500
     aaaggcattg agcttgttag cgacatcacc gacataacgt cacagagctt taaaggcgat      1560
     cctactcgca tctctcaagt actgacaaac ctgattggaa atgcgattaa atttaccgag      1620
     aaaggcagta tcactgttta tgtgaaacag aatgacgata tcgaaccgcg actcaacttc      1680
     tcagttgaag ataccggtat tggtttggca tcgaatcagc ttgaaaagct gttccaacct      1740
     ttcactcagg ccgatagctc gacgactcgt cactttggcg gaactggtct gggactctcg      1800
     atagctaaac gtcttactga gctcatgggg gggagtattt cagtggtaag tactgaaggt      1860
     aaaggcagta aatttagttt caacgttcga gtcgaaatcg cgagcaaaga tgatctgtat      1920
     gccacagacc tgaactccct acccatcctt ttctttagcc gaggaacgcg agccgatcaa      1980
     gttctgggaa aaacgctcaa cttattaaat gccagcctta aggtcgtcaa ggcggctcga      2040
     ttggcaaatt ttaaaccggc aagtatttcg gatacatatc gacccaaact caccattatt      2100
     cacctccccg caggacaaga ggccatcgaa accgaacttg cgaaactggc gagcaataca      2160
     gatttacccg atacaccaat cctacttttc attgcagcca tcgatgaatc aatcatgact      2220
     caatacctca atgaacaaat tttcacttac ctctgtaacc cattgcattt agagcaacta      2280
     ttgatagcgt taaagcagat agaccaaact gcccctcacc ttgttcaacg gcttgctccg      2340
     caaactcaaa gagactggga tctgaaaagc tattttgaag ataggcttcc caagctgctc      2400
     cttgttgaag acaacaaaac caaccaaatg gtggctcaag ggatcattgc cgaattcggc      2460
     ctggagatag acattgcatc agatggggag caggccattg agatactcaa agactcgata      2520
     acctcaccat atcaattaat ttttatggac tgccaaatgc cgcgtttaga cggctatcaa      2580
     acgactcaga tgatcagggc cggttatacg ggtcatcaat acaaacatat tcccatcata      2640
     gctatgacgg cgaatgcgat ggtgggtgac cgggagcgat gtctgcaagc tgggatgaat      2700
     gactacatat ctaaaccact agaccccgat gatattaagc aagctttgtt aagtacgcta      2760
     gctggccatg atacagaaag cgagatgagg aactga                                2796
//

If you have problems or comments...

PBIL Back to PBIL home page