(data stored in ACNUC7421 zone)

EMBL: CP000821.PE291

CP000821.PE291       Location/Qualifiers
FT   CDS_pept        complement(342492..343454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0291"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system protein"
FT                   /note="KEGG: slo:Shew_3789 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34904"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY1"
FT                   /protein_id="ABV34904.1"
FT                   /translation="MTMIKYLASLLITLMLTACGGEKPQPQITIAINPWPGYELLYLAE
FT                   KKGFFEKVGINIKLVQTATLSDAQRAYINGRVDGFTSTIVEAVQAQEFGGEPLTIALLA
FT                   DYSNGGDVILGSESFQSITDLKGKKVGCEVSSLGIYILARALAVSDMSLDDVQIVNMEQ
FT                   GNAHQALAYGQIDAMVTYPPYSFDILNDKKLASHRIFTTAEIPNEILDTVSLSKGVIAR
FT                   NPKLTSQLQQAWQLAMDYLEQHPEEAVKHMAEREQISEIEFNQALSDIHLLSSMEQKQL
FT                   LKDKEKLTKLSKSVCNTLNQVGAFNSSCLHVESLFHSGI"
     atgaccatga taaaatactt ggccagcctt cttattaccc tcatgctaac agcttgcggt        60
     ggcgagaaac ctcaaccgca aataaccatc gcgattaacc catggccagg ctatgaattg       120
     ctctatttag ccgaaaagaa aggcttcttc gaaaaagtag gcatcaatat aaaactggta       180
     caaaccgcca ccttatcgga cgctcaacgg gcctacatca atgggcgagt cgatggtttt       240
     accagtacca tagtggaagc cgttcaggcg caggagtttg gaggagaacc attaaccatt       300
     gcactactcg ccgactattc aaacggtggc gatgtgattt tagggagtga gtcgtttcaa       360
     tccattaccg atttaaaggg taagaaagta ggttgtgagg tcagctctct cgggatctac       420
     atcttggcaa gagcgttagc ggtatcggac atgtcgctcg atgatgttca aattgtgaat       480
     atggaacagg gaaatgccca tcaagcgtta gcctatggac agatagacgc catggttacc       540
     taccctccct actctttcga tattctaaat gacaagaagc tcgcaagcca tcggatattc       600
     acgacagctg agatccccaa cgaaattctc gatactgtat ctctatcgaa aggggtcatt       660
     gcccgaaatc caaagttaac ctctcaactg caacaagctt ggcaactggc aatggattat       720
     ctggaacagc atccggaaga ggccgtaaag cacatggctg aacgggaaca gatctcagaa       780
     atcgaattta accaggcgct cagcgatatt cacctgttat ccagcatgga acaaaagcaa       840
     ctactcaaag ataaagagaa gcttactaag ctttcaaagt cggtttgcaa cacgctcaat       900
     caagttggtg cctttaatag ctcctgtcta catgttgaat ctctgtttca ctcaggcatt       960
     tag                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page