(data stored in ACNUC7421 zone)

EMBL: CP000821.PE293

CP000821.PE293       Location/Qualifiers
FT   CDS_pept        345432..347255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0293"
FT                   /product="GTP-binding protein TypA"
FT                   /note="KEGG: slo:Shew_3553 GTP-binding protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34906"
FT                   /db_xref="GOA:A8FPY3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY3"
FT                   /protein_id="ABV34906.1"
FT                   /translation="MLENLRNIAIIAHVDHGKTTLVDKMLAQSGTLETRGEATERVMDS
FT                   NDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAVDG
FT                   PMPQTRFVTKKAFAQGLKPIVVINKIDRPGARPDWVIDQVFDLFDNLGATDEQLDFPIV
FT                   YASALNGFASLDPEVSEGDMTPLFETIVEKVSSPDADAEGDFQMQISQIDYNSYVGVIG
FT                   IGRIKRGSVKTNQQVTIIGADGKKRNGKMGQVLGYMGLDRNEVAEANAGDIVAITGLGQ
FT                   LQISDTVCAPTTVEALPPLSVDEPTLTMTFQVNTSPFAGKEGKYVTSRNILERLEQELV
FT                   HNVALRVEETDSPDRFRVSGRGELHLSILIENMRREGYELAVSRPEVIVKEIDGEMCEP
FT                   FETLTVDVEEDHQGTVIEKLGIRKGDMRDMQLDGKGRVRIDFVIPSRGLIGFQTEFMTA
FT                   TSGTGLIYHSFDHYGPVKGGDIGQRARGVLISNATGKALTFALFNLQERGRLFITHAAE
FT                   VYEGQVVGLHARANDLTVNCLKGKQLTNMRASGTDEAQVLTPHIEMTLEQALEFIDDDE
FT                   LVEVTPLNIRVRKRYLTENERKRHNRAAKDA"
     gtgttagaga atttacgtaa catcgccatt attgcacacg ttgaccatgg taaaactacc        60
     ctggtagaca agatgctggc gcagtctgga acccttgaaa ctcgaggaga agccactgag       120
     cgggtgatgg attcgaacga tcttgaaaag gagcgtggaa tcacgattct ggcaaagaat       180
     acggccatca agtggaatga ttaccgcatc aacatcgtgg atacacctgg tcacgccgat       240
     ttcggtggtg aagttgagcg tgttctctct atggttgatt cagtactgct tcttgttgat       300
     gcggttgacg gccctatgcc gcaaactcgc ttcgtaacta agaaagcatt tgctcaaggc       360
     cttaagccta ttgttgttat caacaagatt gaccgtccag gcgctcgtcc tgattgggtt       420
     atcgatcaag tattcgatct tttcgacaac ttaggcgcta ccgatgagca gctagatttc       480
     ccaatcgttt atgcttctgc attaaacggt ttcgcttctc ttgatcctga agtatcagag       540
     ggtgacatga ctcctctgtt tgaaactatc gttgagaaag tttcatctcc tgacgctgat       600
     gctgaaggtg atttccagat gcagatctct caaatcgact acaactcata cgtgggtgtt       660
     atcggtatcg gtcgtatcaa gcgtggtagc gttaaaacta accagcaggt cactattatt       720
     ggcgctgatg gcaagaaacg caacggtaaa atgggccagg tattaggtta catgggtctt       780
     gatcgtaacg aagttgcaga agcaaatgct ggtgacatcg ttgcaattac aggtcttggt       840
     cagctacaaa tttcagacac tgtctgtgca cctactacag tagaagcact acctccattg       900
     tctgttgatg agccaacact aaccatgacc ttccaggtca acacctctcc attcgctggt       960
     aaagaaggta agtacgtgac ttcacgtaac atccttgagc gtcttgagca ggaattggtt      1020
     cacaacgttg cactacgcgt tgaagagact gatagcccgg atcgtttccg cgtatcgggt      1080
     cgtggcgaac ttcacctatc tatccttatc gaaaacatgc gtcgtgaagg ttacgagcta      1140
     gccgtttctc gtccagaagt tatcgttaaa gagattgatg gcgagatgtg tgagccgttc      1200
     gaaacgctaa ccgttgatgt tgaagaagat catcaaggta ctgttatcga gaagcttggt      1260
     atccgtaagg gtgacatgag agacatgcag ctagatggta agggtcgtgt tcgtatcgac      1320
     ttcgttatcc ctagccgtgg cttgattggt ttccaaactg agttcatgac agcgacttct      1380
     ggtacaggtc ttatctacca ttcattcgac cattacggtc cagtgaaagg cggtgatatc      1440
     ggtcagcgtg cacgtggcgt attgatctct aacgcaacag gtaaagcact gacattcgca      1500
     ttgtttaacc ttcaggaacg tggtcgtctg tttattacac atgctgcaga agtttatgaa      1560
     ggtcaagttg ttggtctaca cgctcgcgct aacgatctta cagttaactg tttgaaaggt      1620
     aagcagctta ccaacatgcg tgcatcgggt accgatgaag cacaggtact gactccacat      1680
     atcgaaatga cacttgagca agcgcttgag ttcatcgatg atgacgagct agtagaagta      1740
     acgccgctga acattcgtgt tcgtaagcgt tacttgactg aaaacgagcg taagcgtcat      1800
     aaccgtgcgg ctaaagacgc ttaa                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page