(data stored in ACNUC7421 zone)

EMBL: CP000821.PE294

CP000821.PE294       Location/Qualifiers
FT   CDS_pept        complement(347570..348784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0294"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: slo:Shew_3549 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34907"
FT                   /db_xref="GOA:A8FPY4"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY4"
FT                   /protein_id="ABV34907.1"
FT                   /translation="MSFVESLTLMLALAYSASLLYWSGKKSGAVVTIIIAVGAGISSLY
FT                   WPLLVALAIAATSLTIFTKLRPEAAKGELRANSLRDGIQHLLALSMLLVGVQFAANTAM
FT                   LKAGITPWLARPDVGDAFLPIAGGIELKAIMTLGLWDQTHPAAAVMLAVVLLTGLLCKR
FT                   AFCGWACPLGLAGEYLYKLRKRFIKQEFMPPAWLDWPLRMLKYLLLAALLYIIIGMPSA
FT                   SIPQYLAGNYHKIADLKMALFFVTPGLITLICFAFILGLSAWRRQGFCRYICPYGALLG
FT                   IISFLSPFKIRRSTQHCLIETKGMNCDKCTRACPANISVHTQKNIRSDECQACMRCVSA
FT                   CPKREALHFSTRNGIKLSARGLTIMLLLIMFIIPLGAYVGDFWHSQTLDQDRIYLIQHL
FT                   KSIGH"
     atgagctttg ttgaatcttt aaccttaatg ctggcactgg cctacagtgc gagcctgctg        60
     tattggagcg gtaaaaagtc gggagcggtt gtcaccatca tcattgcggt cggagccggt       120
     ataagctcgt tatactggcc actgctcgtg gcgcttgcca tcgctgctac ctcactgaca       180
     atcttcacca aactacgacc ggaggccgcc aagggtgaac tcagggctaa ttctctgcgt       240
     gatggtattc aacacctgct tgccctgtct atgttgttag tcggcgtaca attcgccgct       300
     aacaccgcca tgctcaaggc cggaataacc ccttggctgg caaggcccga tgtcggcgat       360
     gcgtttctcc ccatcgccgg gggaatagag ctcaaggcga ttatgacctt aggcttatgg       420
     gatcagaccc acccggccgc cgcagtcatg ttggccgtcg tactgttaac aggcttgctc       480
     tgtaaacgcg ccttctgtgg ttgggcgtgc cccctcggtc ttgcgggaga atatctgtat       540
     aagctgagaa agcgtttcat caaacaggag ttcatgccac cagcttggtt agactggcca       600
     cttagaatgc tgaaatatct gctgttagct gcgctacttt atatcattat cggcatgcct       660
     tcggcctcaa tcccgcaata cttagcgggc aactatcata agatagccga cctcaagatg       720
     gcgctgtttt ttgtcacgcc gggactcatt acattaatct gtttcgcatt catcttggga       780
     ttatcggcct ggcgtcgtca ggggttttgt cgttacatct gcccttatgg cgccctgctt       840
     ggcatcatca gttttctcag tccatttaag atccgcagaa gcactcagca ttgcctaatc       900
     gaaaccaaag ggatgaactg tgataaatgc acccgcgcct gcccggctaa catatctgtt       960
     cacacccaga aaaacattcg ctccgatgaa tgccaagcct gtatgcgctg cgtctccgcc      1020
     tgccctaaga gggaagcatt gcatttcagt acccgcaatg ggattaagct atccgcaagg      1080
     ggattaacca tcatgctgtt actcattatg ttcataatcc cattaggtgc ctatgtcggc      1140
     gacttctggc acagccaaac cttggatcag gatcgtatct atctgataca gcatttgaag      1200
     tcgatagggc attaa                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page