(data stored in ACNUC7421 zone)

EMBL: CP000821.PE295

CP000821.PE295       Location/Qualifiers
FT   CDS_pept        complement(349069..349839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sat:SYN_00385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34908"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY5"
FT                   /protein_id="ABV34908.1"
FT                   /translation="MYNTWYNADALTNDNGDDTGLDVDINAYVQVHRLVHVTEKKLFGA
FT                   NWAYNVIVPMINKETSIADFGVDDSTSFALGDVVLEPLALFWFRDNYEAALGLSVIVPT
FT                   GDYDPADAASPGMGYWSGMLTLGGTYYLDSDKSWSVSGLTRTLVHSEQDDTDIRPGAEF
FT                   IIEGGIGKQFALDEHWLLRPGLSYCASWQISDDSRDGHGTLAGERKTGYGIGGEVNVFY
FT                   LPWLLQGNLRYVNEFGTKNTAKGSSFVFTLTKSF"
     atgtacaaca cctggtacaa cgccgatgct ctgaccaatg ataatggcga tgacacgggg        60
     ctggatgtcg atatcaatgc ctacgttcag gtgcataggc tggtacacgt caccgaaaag       120
     aaacttttcg gtgccaactg ggcctataac gtcatcgttc ccatgattaa caaagaaacc       180
     tcgatcgccg atttcggtgt cgatgacagc acctccttcg ccttggggga tgtcgttctg       240
     gagcctctgg ccctgttctg gttccgtgat aactatgagg cggcgcttgg gttatcagtg       300
     attgtcccca cgggtgacta tgaccctgca gacgccgcat cgcccggtat gggctattgg       360
     tcaggcatgt taacgcttgg aggaacctac tacctggatt cagacaagtc ctggagtgtc       420
     agtggcctaa cccgtaccct ggtgcactcg gagcaggacg ataccgatat tcgtccgggc       480
     gcagaattta tcatagaggg tggcataggt aagcagttcg cactggatga acattggttg       540
     cttcgtccgg ggttgagcta ttgtgccagc tggcagatca gcgatgacag ccgggatggc       600
     cacggaacat tagccggtga acgtaagact ggctatggta ttggcggtga ggtcaacgtt       660
     ttctatctgc cctggctact tcagggtaac ctgcgctacg tgaatgagtt tggcaccaaa       720
     aataccgcaa aaggttcatc atttgtcttc accctgacca agtcattcta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page