(data stored in ACNUC7421 zone)

EMBL: CP000821.PE296

CP000821.PE296       Location/Qualifiers
FT   CDS_pept        complement(350171..351406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0296"
FT                   /product="Arabinose efflux permease-like protein"
FT                   /note="KEGG: mem:Memar_0422 major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34909"
FT                   /db_xref="GOA:A8FPY6"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY6"
FT                   /protein_id="ABV34909.1"
FT                   /translation="MRPDHRNFYRVTRMAHRNHFQLLFVINFIVTLGFGICDTFFSVYV
FT                   FELGGRGALLALPLISYSVAKAVFSPFMGRCSDTFGPEKIMLVSLTIYLLVSVLFLVST
FT                   NLFILAISRLLQGVACAMFRPVIVSLVSESAIKEKRSSIMGTFDISFYAALSFGPIVGG
FT                   YMKDQLGFSAIFSGVTLLCILAILLCTCCVRDSSARVATTHSSRNKPSSLIQPIIRSRN
FT                   LRGLLAFIFGRASCISLTGTFLPIILTEELKLTGTQIGIVMASSCLTITLLLRPMGMLA
FT                   DRVSHAILIILGGISVSIIYLIIPATLTFTQIIFATTLLGLFSALSQPACTAMLVEEGT
FT                   HYGTGNTVGIFNGAMNLGFIFGPIFGAFILSGFGIDAVFYSAGVIGASTILLFALITHP
FT                   SLLSPVDSRCKN"
     atgagacctg atcaccggaa cttctataga gttacaagaa tggcgcatcg caatcatttc        60
     cagctcctct tcgtgatcaa ctttatcgtt accttgggtt ttgggatctg cgataccttc       120
     ttctctgtgt atgtgtttga actgggagga agaggcgcac tgttggccct accgctgata       180
     tcctactcag tggcaaaagc agttttcagc ccttttatgg ggcggtgttc ggacaccttc       240
     ggccccgaaa agataatgct tgtctccctc actatctacc tgctggtctc agttttattc       300
     ttagtctcta ccaacctgtt tatccttgcg atctcacgct tacttcaggg cgttgcctgc       360
     gccatgttca ggccggttat tgtttccttg gtcagcgagt ctgccattaa agagaaacgc       420
     tcctcgatta tggggacctt cgatatctct ttctatgcag ccctgtcctt cgggccgata       480
     gtgggtggtt acatgaaaga tcaactgggg ttctcggcca tattctcagg ggtgacactc       540
     ctctgtatct tagccatttt gctctgcact tgctgcgttc gagatagttc ggctcgtgtc       600
     gccaccacgc actcaagccg caataaaccg tcatccctca ttcagcccat catccggagc       660
     cgaaacttaa gaggattact ggcctttatc tttggacgag ccagctgcat ctctcttaca       720
     ggcacatttc ttcctattat tttaactgaa gagcttaagt taaccgggac tcaaataggg       780
     atagtgatgg cctcaagctg tctcactatc acgctccttc tgcggcctat gggcatgctt       840
     gcggataggg tttctcacgc catattaatc atccttggcg gcatatctgt ctcaataatc       900
     tatttgatca ttcccgccac actcaccttc acccaaatta tcttcgcaac caccctcctc       960
     ggcttattta gcgccctgtc acagcccgcc tgcaccgcca tgctggtaga agagggaacg      1020
     cattacggca caggcaacac ggtggggata ttcaatggtg caatgaactt aggttttatt      1080
     ttcggcccca tttttggcgc gtttatcttg agtggcttcg gaatagacgc cgtattttac      1140
     tcggcagggg taataggcgc ttcaacgata ttgttatttg ccctaattac tcacccctct      1200
     ctgctttcgc ctgtcgacag cagatgcaaa aactaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page