(data stored in ACNUC7421 zone)

EMBL: CP000821.PE298

CP000821.PE298       Location/Qualifiers
FT   CDS_pept        complement(351912..353438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0298"
FT                   /product="putative flavoprotein subunit of a reductase"
FT                   /note="KEGG: eca:ECA0910 putative flavoprotein subunit of a
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34911"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY8"
FT                   /protein_id="ABV34911.1"
FT                   /translation="MNKLSMAIALSLLSASSYAANYTKNVDVVVIGSGASGMAAAAAAE
FT                   EKGLTTVLLEKQANIGGSALYIEGTFAVETEQQKSMYIGLTKDWAYKNHMEFNHGFING
FT                   PLMRKWINRSDESIKWMEEKGVTFHDVRTLFEDGNRTWHIFKDGKGVEFVQKMEQSFTK
FT                   NGGKIYTETPATELVYKDGKVVGVIAEDGEGDTYTFNAKGGVIVATGGFINNPKMLKKF
FT                   GIRTDHLIVGPKKGRDGDSIKWWEETGARLEGMKTHLAIGAWLYGKDPNTQLSHPEHTT
FT                   VYSQMASLLRQPYMWVAKDGKRFIDESQAPLWHNTGPAVERVGNGYFAVFDDNMREYMK
FT                   TDGIDISHSDWVRVGHKLDLLDEGIEVGQKEGWLVKSNTIEGLAKKMGIDVATFKQTVV
FT                   DANRYAINGVDEEFPKNRKYVRSMDKPPYFAVKGQNATLITLGGPTTDTDMQVLREKDM
FT                   KPVGGLYVVGCEVGGVYGDSYNLTLEGMASSFAINSGRFAAEHIAQKMKL"
     atgaacaaac tttccatggc aattgctttg agcttattaa gcgcgagcag ttatgcggca        60
     aattacacca aaaatgtcga tgtggttgta attggctccg gcgccagtgg tatggcagcc       120
     gcggctgccg ccgaagaaaa aggtctgaca accgtactgt tagagaagca agcgaacatc       180
     ggtggttcgg cgctctatat cgaaggtact ttcgccgttg aaactgaaca gcaaaaatcg       240
     atgtacattg gcctgaccaa agactgggct tataagaacc atatggaatt caaccatggt       300
     tttatcaacg gtcccttaat gcgcaaatgg attaatcgtt cagacgagtc tatcaaatgg       360
     atggaagaga aaggcgtcac cttccatgac gtgcgcaccc tcttcgaaga cggtaaccgt       420
     acctggcaca tctttaaaga tggtaaaggc gtcgagttcg tgcagaagat ggagcagtct       480
     ttcaccaaga acggcggtaa gatctacacg gaaacaccgg caactgagct tgtctataaa       540
     gacggaaaag tggtcggtgt tatcgccgaa gatggcgaag gcgataccta tacctttaac       600
     gctaagggcg gtgtcatcgt tgctactggt ggcttcatca acaaccctaa gatgttaaaa       660
     aaattcggta tccgcaccga ccacctgatt gtaggtccta aaaagggtcg tgatggcgac       720
     agtatcaagt ggtgggaaga gacaggcgca agactggaag gtatgaagac ccatctggca       780
     atcggcgcat ggttatatgg caaagatcca aacactcagc taagtcaccc ggagcatacg       840
     acagtctatt cacagatggc ctctctatta cgccagccat acatgtgggt tgctaaagac       900
     ggtaagcgtt tcatcgatga aagccaggcg ccactatggc acaacacagg ccctgcggta       960
     gaacgtgtgg gtaatggcta cttcgccgtc ttcgatgaca acatgagaga gtacatgaag      1020
     acagatggta tcgacatctc tcacagtgac tgggtgcgtg ttggtcataa gctcgacttg      1080
     ctggacgagg gtatcgaagt cggccaaaaa gagggttggt tagttaaatc aaacaccatc      1140
     gaaggtctgg ctaaaaagat ggggattgat gtagccacct ttaagcaaac agtggttgac      1200
     gccaaccgtt atgccatcaa cggtgtagat gaagagttcc ctaaaaaccg caagtacgtt      1260
     cgttctatgg acaagcctcc ttactttgcc gttaaaggtc aaaacgccac gctaatcacc      1320
     ctcggtggcc caaccaccga caccgatatg caggttctgc gtgagaaaga tatgaagcct      1380
     gttggcggcc tatatgttgt aggttgcgaa gtgggcggcg tatatggtga ttcatataac      1440
     ctgactcttg agggtatggc cagctcattc gccatcaact cgggtcgttt cgctgccgag      1500
     cacatcgcac agaagatgaa gctgtag                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page