(data stored in ACNUC7421 zone)

EMBL: CP000821.PE3

CP000821.PE3         Location/Qualifiers
FT   CDS_pept        complement(3635..3892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0003"
FT                   /product="protein of unknown function DUF37"
FT                   /note="KEGG: slo:Shew_3867 protein of unknown function
FT                   DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34616"
FT                   /db_xref="GOA:A8FP43"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP43"
FT                   /protein_id="ABV34616.1"
FT                   /translation="MAKTQSPLQWLATTLIRGYQVFISPFLGANKCRFHPTCSTYAIEA
FT                   IRLHGFAKGSWLAARRILKCHPLHPGGIDPVPPKKHRCNK"
     atggcgaaaa ctcaatcgcc gttacaatgg ctagcgacca cgttaattcg tggctaccaa        60
     gtcttcatca gccccttttt aggggctaat aagtgccgct ttcatccaac ttgttccaca       120
     tacgcaatag aagcaattcg tttgcacgga tttgcaaaag gcagttggct agcagcaaga       180
     cgcatattaa aatgtcaccc tttacatccg ggcggaatcg accccgtccc cccaaaaaaa       240
     cacaggtgta ataaatag                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page