(data stored in ACNUC7421 zone)

EMBL: CP000821.PE30

CP000821.PE30        Location/Qualifiers
FT   CDS_pept        35726..36166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34643"
FT                   /db_xref="GOA:A8FP70"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP70"
FT                   /protein_id="ABV34643.1"
FT                   /translation="MNFSFPNKMSIFTRVFQLILCITLIFILAKLFFEAGVLGVNPILK
FT                   NIVFISSCLAIGWIFKIKYYWNYQQDHQDHLSVILGINLFGFSFVKIFDNGILVMKHRG
FT                   FWKKQLNLDVNSSLTVTVRLDQSQSPSFGCLAVKNSKQLVST"
     atgaatttta gcttccctaa taagatgagt atttttactc gtgtttttca acttattctg        60
     tgcataaccc ttatctttat tttggctaaa ctattttttg aggctggagt attgggagtt       120
     aatcccatac tgaagaatat tgtttttata agttcttgtc ttgctatcgg ctggattttc       180
     aaaattaagt attattggaa ttatcagcaa gatcatcaag atcatctttc agtgatactt       240
     ggcataaatt tgtttgggtt ctcattcgta aaaatatttg ataatggaat tttagttatg       300
     aaacatagag gtttttggaa aaagcaacta aatctggatg ttaactcatc acttaccgtt       360
     acggttcgtt tagatcaaag tcaatcacca tcttttgggt gtctcgctgt taagaactca       420
     aaacagcttg tatctacata a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page