(data stored in ACNUC7421 zone)

EMBL: CP000821.PE300

CP000821.PE300       Location/Qualifiers
FT   CDS_pept        complement(355662..356309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34913"
FT                   /db_xref="InterPro:IPR021342"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ0"
FT                   /protein_id="ABV34913.1"
FT                   /translation="MKKYISIAIIATSLLLTGCQSAYYGAMEKVGYHKRDIMVDRVEDA
FT                   KESQEDAQKQFSSALEEMQALLNHDGGDLEGAYNKAKDEYESAQDAADDVTKRIDKVED
FT                   VAEALFDEWQSEIGEISKASLRRNSEAKLRETKRSYNQLVKSMRRAESKMPPVLTAMKD
FT                   NMLYLKHNLNAQAIGAIKGEFTSLQTDISGLIKEMNKSIDESNKFIASLEGN"
     atgaagaaat atatctctat tgcgattatc gccaccagcc tgttgctaac aggttgtcag        60
     agcgcctact acggcgccat ggaaaaagtg ggctatcaca agcgtgacat catggtcgac       120
     cgcgtcgaag acgctaaaga gtctcaagag gacgcacaga agcagttcag ctctgcactt       180
     gaagagatgc aggcactgtt aaaccacgat ggtggtgatc tggagggcgc ttacaataaa       240
     gccaaagatg agtatgagtc cgctcaggat gccgccgatg atgtcactaa gcgtatagat       300
     aaggtcgaag atgtggccga agcactattt gacgaatggc agagtgagat tggtgagata       360
     agtaaggcca gtctgcgccg taacagcgag gctaagcttc gcgagactaa gcgctcatac       420
     aatcagctgg taaaaagcat gcgccgcgcc gagagtaaga tgccacccgt gttgacggcc       480
     atgaaagata atatgctcta cctcaagcat aacttaaacg cccaggccat aggcgccata       540
     aaaggtgagt tcaccagcct gcagaccgat atctcgggtc tgatcaagga gatgaacaag       600
     tctatcgatg agtcgaacaa gtttatcgcc tctctggaag gtaattaa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page