(data stored in ACNUC7421 zone)

EMBL: CP000821.PE301

CP000821.PE301       Location/Qualifiers
FT   CDS_pept        complement(356351..356578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34914"
FT                   /db_xref="GOA:A8FPZ1"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ1"
FT                   /protein_id="ABV34914.1"
FT                   /translation="MSQQGSAGNVIAAIASFFFAGLGQLVQGRILAAIIFCLATYASYG
FT                   IATFTFGIFLVVALPLHLWCIIDAARYKAD"
     atgtcacaac aaggatcggc aggcaatgtc attgccgcta tcgcaagctt ctttttcgcg        60
     ggattaggtc aactcgttca ggggcgcata ctcgctgcaa ttatcttttg tctagctacc       120
     tacgcttcat acggtattgc cactttcact tttggcatat ttctagtcgt tgcactcccc       180
     ttgcaccttt ggtgcatcat cgacgcagca aggtataaag ccgattaa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page