(data stored in ACNUC7421 zone)

EMBL: CP000821.PE304

CP000821.PE304       Location/Qualifiers
FT   CDS_pept        358574..359143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34917"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ4"
FT                   /protein_id="ABV34917.1"
FT                   /translation="MKKLIIAGLVTMLSACAATDKSDTTASATIAPERVTLGGMTNEDA
FT                   AKTLFDALIKKNYLATMASPSRIALQFDDNQFVLQPSINPDGIDRIMMNRFYAVHPKLV
FT                   GSQDLLILIGTLNHKLNFAKFTLRENGAIIQVQGAATFVNTIELEEIRRFMLWTDEGLR
FT                   QVGHSLPKGSEQLIKPIPVMQQSRSL"
     atgaaaaaac taattatcgc aggacttgtg acaatgctca gtgcctgcgc agccaccgat        60
     aagagcgata cgacggcgag tgcaaccatt gcaccggaga gggtgacatt aggtggcatg       120
     acgaatgagg atgccgctaa gacattgttc gatgccttga ttaaaaagaa ctacctcgcc       180
     accatggcat caccaagccg tattgcattg cagtttgatg ataaccagtt tgtacttcag       240
     cccagtatca atccagatgg gatcgatcgc attatgatga atcgcttcta cgccgttcat       300
     ccgaaattgg tgggtagtca agatctactc atattgattg gcacgttaaa tcataagctt       360
     aactttgcaa agtttaccct gcgtgaaaac ggcgccatta ttcaggtgca aggcgcggcg       420
     acctttgtga ataccatcga gctcgaagag atacgtcgtt tcatgttatg gaccgatgaa       480
     gggctgcgtc aggtcggcca ttcattgcca aaaggttctg agcagttgat taagccgata       540
     ccggtaatgc agcagtctcg gtctttgtaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page