(data stored in ACNUC7421 zone)

EMBL: CP000821.PE306

CP000821.PE306       Location/Qualifiers
FT   CDS_pept        359652..360125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0306"
FT                   /product="thioesterase domain, putative"
FT                   /note="KEGG: slo:Shew_3541 thioesterase domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34919"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ6"
FT                   /protein_id="ABV34919.1"
FT                   /translation="MTASDERGQQIASLLKELTETWHQTIPVSEFMQISPLGYHDNRLK
FT                   VTAPLSPNINLHQTMFAGSIYTLATLTGWGMLWLQQRLAEVNGDIVLADGHIRYLAPIS
FT                   GAPTAKVSWPDVDLSRLTLGRRVKVKLVVEIYVGDRCCAEFEGIYVSQPVPHT"
     gtgaccgctt ccgatgagag gggtcagcag atagcttcac tcctgaagga gctgactgaa        60
     acctggcatc aaacgatccc cgtgagtgag tttatgcaga tatccccgct tggatatcat       120
     gataatcggc tgaaggtcac agccccccta tctcctaata tcaacttaca tcaaaccatg       180
     tttgccggca gcatctatac cctggcaact ttgacgggct gggggatgct gtggctgcag       240
     caaaggctgg cagaggttaa cggcgatatt gtgttggccg acggccatat tcgttactta       300
     gccccgattt caggggcacc aacagcaaag gtaagctggc cggatgttga tctttctcga       360
     ttgactctag gacgtcgggt taaggtgaaa ttggtggtgg aaatatacgt cggtgatcgc       420
     tgctgcgccg agtttgaagg gatttatgtc agtcagccag ttcctcatac ataa             474
//

If you have problems or comments...

PBIL Back to PBIL home page