(data stored in ACNUC7421 zone)

EMBL: CP000821.PE307

CP000821.PE307       Location/Qualifiers
FT   CDS_pept        360318..360911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0307"
FT                   /product="(acyl-carrier-protein) phosphodiesterase"
FT                   /note="KEGG: slo:Shew_3529 (acyl-carrier-protein)
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34920"
FT                   /db_xref="GOA:A8FPZ7"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPZ7"
FT                   /protein_id="ABV34920.1"
FT                   /translation="MSKVLILKSSILGDYSQSGQLVEHLKQHWEQQGAEISVRDLAAEP
FT                   LPMLDGEIASGLRGGDQLSARQEQALLLSDSLIQELKAHDTIVIAAPMYNFSIPTQLKN
FT                   WIDLVARAGVSFTYTETGPKGLITGKRAVLITTRGGVHKGGASDHVVPYLKTVLGFIGI
FT                   EEVETVYSEALNMGPEASKQGIESAQQALEKIVA"
     atgtcaaaag tactaatttt aaagtcgagc attttaggcg attactctca atccggtcag        60
     ttggttgagc atcttaagca gcattgggaa cagcagggag ccgagatcag cgtacgtgat       120
     ctggccgcag agcctctgcc aatgctcgat ggtgagattg catcgggttt acgaggtggt       180
     gatcagttat cggcgcgtca ggagcaggca ttgctactgt cagactcgct tattcaagag       240
     cttaaagccc atgacaccat agtgattgca gcgcctatgt ataacttcag tattcctacg       300
     cagcttaaaa actggatcga tctggttgcg cgtgccggcg tgagtttcac ctacacagaa       360
     accggaccta aaggtttgat tacgggtaag cgagccgttt tgatcacgac gcgaggcggc       420
     gtacataaag gtggcgcctc agatcatgtg gttccttacc ttaagacagt acttggattt       480
     atcggtatcg aagaggttga aaccgtgtat agcgaagctc ttaatatggg acctgaggca       540
     tctaagcagg ggatcgagtc ggctcagcaa gcattagaaa agatagtggc ttaa             594
//

If you have problems or comments...

PBIL Back to PBIL home page