(data stored in ACNUC7421 zone)

EMBL: CP000821.PE308

CP000821.PE308       Location/Qualifiers
FT   CDS_pept        complement(361077..361397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0308"
FT                   /product="rhodanese domain protein"
FT                   /note="KEGG: sbl:Sbal_0322 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34921"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ8"
FT                   /protein_id="ABV34921.1"
FT                   /translation="MLQSLLSKLAGAGPDKRSWELIKQGARVIDVRTPEEFGSGHLPQA
FT                   INVPLSQISTWLIDQDPKQSFVLYCAAGIRAQKACDQLKCSGFPNVINAGSLKDLLSYQ
FT                   AT"
     atgctacagt ctctgctatc taaactcgcc ggcgccgggc ccgataaacg cagctgggaa        60
     ctcatcaaac aaggcgccag ggttattgat gtaagaactc ccgaagagtt cggctctggg       120
     catctgccgc aagccatcaa cgtacctctg agccaaatat cgacctggct gatagatcaa       180
     gatcctaagc agagtttcgt actctactgt gcggcgggga tcagggctca aaaggcctgc       240
     gatcagctta aatgcagcgg ctttcccaat gtcatcaatg ccggctcact gaaagacctt       300
     ctcagttatc aagcgactta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page