(data stored in ACNUC7421 zone)

EMBL: CP000821.PE309

CP000821.PE309       Location/Qualifiers
FT   CDS_pept        complement(361522..362268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34922"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ9"
FT                   /protein_id="ABV34922.1"
FT                   /translation="MIKHITLALVLTLSSVAGQALAETFTEAEYVAIFNGDNINKQKQA
FT                   IDSLVLAGLSDPKVFDTLHAKFKASLPQAVNNASIDYSAWLLKGLAYSGDEKYLQTFNE
FT                   IIAGDYPGKLKKYAKKSIPTLKQYKSWTPILSDKSQYAASETREVNVIANALRSDELEL
FT                   KRYAAKRMINHSLYAPYLLSVLDSELKDPRLLKHEKLAINTYAYMAKALASSGEPEYKA
FT                   TLEHIAKQSSERKLQKYAKKYLKTYY"
     atgataaaac atatcacctt agccttagtg ctaaccctaa gctccgttgc cggtcaggca        60
     cttgccgaaa catttaccga agccgaatat gtggccattt ttaacggtga taatattaat       120
     aagcagaagc aagccatcga ctctctggta ctggcaggtc tgtcggatcc taaggtattc       180
     gatacattgc acgctaaatt taaggcgtca ctgccacagg ccgtcaacaa cgccagcatc       240
     gattacagcg cctggctact taaagggcta gcctactccg gagatgagaa gtacctgcaa       300
     actttcaacg agatcatagc aggcgactac ccaggtaagc tgaagaagta tgcaaagaag       360
     tctatcccga ctcttaagca gtataagagc tggacgccta tcctaagtga caagagccaa       420
     tatgcagcct ctgaaacccg agaggtaaat gtgattgcta atgcgctgag aagtgatgag       480
     ttagagttaa agcgttacgc cgccaaacga atgatcaatc actcactgta cgctccctat       540
     ctgttatcgg tcttagacag tgaactcaag gatccacgcc tgctcaagca tgaaaagctc       600
     gcaattaaca cttatgccta catggcaaag gcgctggcaa gctcgggaga gccggagtac       660
     aaggccactc tggagcatat cgcaaagcaa agctcagaga gaaagttaca aaaatacgca       720
     aagaagtacc tgaaaaccta ctattga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page