(data stored in ACNUC7421 zone)

EMBL: CP000821.PE31

CP000821.PE31        Location/Qualifiers
FT   CDS_pept        complement(36602..38044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0031"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="KEGG: slo:Shew_3740 potassium uptake protein, TrkH
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34644"
FT                   /db_xref="GOA:A8FP71"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP71"
FT                   /protein_id="ABV34644.1"
FT                   /translation="MLNLRPLLFILGIFLSTLTVFMFVPLFFALFYGEETVGAFMIASL
FT                   LTGTCASACMHQGRGHQLHLNIRDMFLLTSLTWLIVSFFAAMPFTLYHGINYTDAFFET
FT                   MSGITTTGSTVLSGLDKMDHSILIWRSLLQWMGGIGFIVMAVAVLPFLNVGGMRLFRTE
FT                   SSDWSDKAIPRTQDMAKHLFYIYIFLTICCGLAYHWAGMSWFEAINHSMTTLSTGGYST
FT                   SDSSMAAFSNQAHWVGTLFMAAGGLPLLIFVNCIQHRSLWVWNDAQVKGFLLFLSTVSI
FT                   GLAFWLWLGHEMTPIDALRLASFNVVSVVTTTGYGLTDYTAWGALANVAFLFLMFVGSC
FT                   SGSTSGGIKIFRFQIAIAIMREQLKQQFHPNGVFKERYNNRVISEDIVRSLVTFVLLFM
FT                   LVIVVLSIILVMTGLDPTTSFTGAVTAVTNVGPGLGHTIGPAGNFSTLPDVAKWALAIG
FT                   MLLGRLEILTVAVLFHPGFWKY"
     atgctgaatc ttcgacctct gctgtttatt ttgggcatat ttctgtcgac gctgacagta        60
     tttatgttcg tcccgctttt ctttgccctg ttttatggcg aagaaacggt gggcgcattt       120
     atgatcgcct ctctgctcac tggtacatgt gccagcgcct gcatgcatca gggacgaggt       180
     catcaacttc acctgaacat ccgtgatatg tttctgttga ccagcttaac ctggttaatc       240
     gttagctttt ttgccgcaat gccattcacc ctctatcacg gcattaatta taccgacgca       300
     ttttttgaaa ccatgtccgg cataacgaca accggctcga ccgtcttgtc aggtctggac       360
     aagatggatc acagcatatt gatctggcgc tctctactcc aatggatggg cggcataggt       420
     tttatagtga tggccgttgc ggtacttccc ttcctcaatg tcggtggtat gagactgttc       480
     agaaccgagt catccgactg gagtgataag gccatccccc gcactcaaga tatggctaag       540
     catcttttct atatctacat attcttgact atttgctgtg gcctcgccta ccactgggca       600
     ggcatgagct ggtttgaagc gatcaatcac tcgatgacaa cactgtcgac cgggggctac       660
     tctacctctg acagctctat ggctgccttt tccaatcagg cgcactgggt aggcactctc       720
     tttatggctg ccggaggctt gccactatta atattcgtca actgtataca gcatcgatct       780
     ctgtgggttt ggaatgacgc ccaggttaaa gggtttctgt tgtttttatc gactgtatct       840
     atcggcctgg ccttctggtt atggctgggt catgagatga cgccaatcga tgcactacgc       900
     cttgccagct ttaatgtcgt atccgtggta acgactacgg gttatggcct caccgattac       960
     actgcctggg gggcattagc caatgtcgcc ttcctgtttt tgatgtttgt aggcagttgt      1020
     tctggctcta catccggcgg catcaaaatt ttccgcttcc agatagccat tgcgattatg      1080
     cgggagcaac tcaagcagca gttccacccc aatggcgtgt ttaaagaaag gtataacaac      1140
     agggttataa gtgaagatat tgtccgctcg ctggtaacct tcgttcttct atttatgctg      1200
     gttatcgtcg tactgtccat tattctggtg atgaccggac tcgatcccac caccagtttt      1260
     accggcgcag taacagcagt gacaaatgtt ggtcccgggc ttgggcatac tatcgggccg      1320
     gcgggtaact tctcgaccct acccgatgtc gccaaatggg cactggcaat cggcatgcta      1380
     ttgggtcgat tggagatcct gacggttgcg gtgttgtttc acccaggctt ttggaaatac      1440
     tag                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page