(data stored in ACNUC7421 zone)

EMBL: CP000821.PE311

CP000821.PE311       Location/Qualifiers
FT   CDS_pept        complement(363567..364292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0311"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /note="KEGG: sfr:Sfri_0338 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34924"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ01"
FT                   /protein_id="ABV34924.1"
FT                   /translation="MNKRILITGSSRGIGKAIALQLAEAGYDIALHFHSNREAAELTKQ
FT                   ALLEHGVNVSSLQFDIADREGVKTSIESDIEQHGAYYGVVLNAGINCDTAFPAMTEDEW
FT                   DSVVHTNLDGFYNVIHPTIMPMIQTRLGGRIITMASVSGIAGNRGQVNYSASKAGIIGA
FT                   TKALSLELAKRKITVNCIAPGLIETDMVADIPKDMVKEIVPMRRMGKPSEIAGLAKFLM
FT                   SEDAAYITRQVISVNGGMI"
     atgaacaaaa ggatattaat aacaggctcc agcagaggaa ttggcaaggc gatagcattg        60
     caactggctg aggccggata cgatattgcc ctgcactttc acagcaaccg cgaagcggca       120
     gagctaacga aacaagcgct actcgaacat ggtgttaacg tctcctctct ccagtttgat       180
     attgccgatc gtgaaggggt caaaaccagc atagagagcg atattgagca gcacggtgcc       240
     tattatggcg tggtgcttaa tgccgggatt aattgcgata ccgcattccc ggccatgaca       300
     gaggatgaat gggacagcgt cgttcacacc aacttagatg gtttctataa cgtcattcac       360
     ccaacgatta tgccgatgat acagacccgc ctcggtggca gaattatcac tatggcctcc       420
     gtctccggta ttgccggtaa ccggggacaa gtcaactata gcgcctctaa agcggggatc       480
     attggcgcga ccaaggcact gtcattggag ttggcgaaac gaaaaattac cgttaactgt       540
     atcgcccccg ggctaatcga gaccgacatg gtagcggata tccctaaaga tatggtcaaa       600
     gagatagtcc ctatgcgccg catgggcaaa ccctctgaaa ttgccggcct ggctaaattt       660
     ctgatgtctg aggatgccgc ttacattacc agacaggtga tctcggttaa cggaggtatg       720
     atctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page