(data stored in ACNUC7421 zone)

EMBL: CP000821.PE312

CP000821.PE312       Location/Qualifiers
FT   CDS_pept        complement(364299..364787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0312"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase, FabA/FabZ"
FT                   /note="KEGG: slo:Shew_3524
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase,
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34925"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ02"
FT                   /protein_id="ABV34925.1"
FT                   /translation="MTQEYLLPEPLSQLPVAEVVPHRDPMILIDTLVEHGPDTLLTQTN
FT                   ITKQSPYFDAAIDAVPNYVGIEYMAQSIAALAGLEAKSRGEAIRVGFLLGSRKLKMHRP
FT                   NYTLGESYQTRVTRLYQEESGLAVFDCQVFHGDTLVAEANVNVFQPQDALAYISESQG"
     atgacccaag aatacctttt acccgaacca ctgtctcaac tccccgtcgc cgaggtggta        60
     ccccatagag acccgatgat attaatcgat actctggttg agcatggacc ggataccctg       120
     ttaactcaga ctaatattac caagcagagc ccctacttcg atgccgcgat tgatgccgta       180
     cccaattacg tcggaatcga atatatggcg cagagtattg ctgcgctcgc cgggcttgag       240
     gcaaagtctc gtggcgaggc tatccgggta gggtttctct taggaagtag aaaattaaag       300
     atgcaccggc caaattacac cttgggtgag agctatcaga ccagggtgac ccgcctgtat       360
     caagaagagt ccgggttggc tgttttcgat tgtcaggtat ttcatggcga taccttagtt       420
     gccgaggcaa atgtaaatgt atttcagcct caagatgccc tcgcctatat ttcagagagt       480
     caaggataa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page