(data stored in ACNUC7421 zone)

EMBL: CP000821.PE314

CP000821.PE314       Location/Qualifiers
FT   CDS_pept        complement(366060..366692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34927"
FT                   /db_xref="InterPro:IPR021675"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ04"
FT                   /protein_id="ABV34927.1"
FT                   /translation="MVQFHNTIPDRLKRGKGICVLICLTMLVSACSQTLQRQTCVALAK
FT                   GVSYCLAPIPSDNKARSATQQVAINVNDSRHELLSHLELDREKLTLVGLAPLGQALFTL
FT                   VFDGASLNSQQSMLLGDEFKAEYLLALIQLIYWPLEDVNAHLQGATLTSPECDAPRCRR
FT                   IYATGNDTKADQQESILKIRFDKREPWKAEVELAIPQANFELKITPV"
     atggtccaat ttcacaacac gattcctgac aggttgaagc gcggcaaagg gatctgtgtt        60
     cttatctgtc tgacgatgct tgtcagcgcc tgcagccaga ccctgcaacg acagacctgc       120
     gtggccctgg ccaaaggtgt cagctactgc cttgcaccta tcccatcgga taataaggca       180
     cgctcggcga cccaacaggt agccattaac gtgaatgatt cccgccatga actcctgagt       240
     catttggagc tggatagaga gaagctgacg ctggtcggtt tggctccatt agggcaagcc       300
     ctgtttactt tagtcttcga tggcgcgagt ctgaatagcc aacaaagtat gttgttaggt       360
     gatgaattta aagccgaata cctgcttgca ctcatccaac tgatatactg gccactcgag       420
     gatgtaaatg cccatttaca aggtgcaaca ctaacatctc ccgagtgtga tgcgccgcga       480
     tgtcgaagaa tatatgctac ggggaatgac actaaagcag atcagcaaga aagcatcttg       540
     aagattcgtt ttgataagag agagccatgg aaggcagagg tcgaactcgc gatccctcag       600
     gccaattttg aacttaaaat aactccggtt taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page