(data stored in ACNUC7421 zone)

EMBL: CP000821.PE316

CP000821.PE316       Location/Qualifiers
FT   CDS_pept        complement(367983..370397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34929"
FT                   /db_xref="GOA:A8FQ06"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ06"
FT                   /protein_id="ABV34929.1"
FT                   /translation="MIDKLALRLSQYPARLKFALWVMLLCITTLTGIQLWQGGAKIQSD
FT                   ILAMLPKLKEDPLTETALARVEEQLSNTVYIALLAEDKSQAVTAANTLIESLSSDNRDA
FT                   FVDIRSADLNQAQALNHFYFNHRFNLLTQAQASALSSGKLSELLRQAQLQLYNAFGYAN
FT                   SGLIANDPLLLYPDNLQALAPKQRLQVQQGILLGQWSPNETDESSKPAAKVAAIVMAKG
FT                   LGSAFNPNTQELQMAVLQEAFETVESQNKQVAFLKAGALFHASAATKSAKSEVSTLGLA
FT                   SLIGVSLLVWLAFRSVMPLGIALLTITTSLLTAVVMTLLIFSELHLLTLVFGTSLIGIA
FT                   IDYNFHFYCERLAQAEKSANEIIRKIFPAITLALLTSVLAYSGIGLAPFPGMQQVAVFC
FT                   AAGLFGAYITLSLAYPLLASGPLPSGEKPLSMAAAYLTKLNSISRFLNYKIGGVLLALS
FT                   VIISAFGLYQLTSDDDIRNLQQSPESVSDEEQQLRGILSGGTDNQFLLVRGETEEQLLQ
FT                   RLEILSPKLNNAVEKGLIGNAFSLSTYLPSRSKQEDNYQLQGLIYQQNLASIVENLGLD
FT                   DSLISDLAEAYQKAKGSYIDAESFISSDAGKLFKPLWITPTPLQDQYGAIVLLGGITEI
FT                   DKLESFFSKLSYVQLVDRVGEISGVMGQYRQLTLWLLAIAMAIAALIFSTRFGIKLAAL
FT                   VVAVPALSAVLTLSLLGLIGAPLTLFHALALILVFGIGVDYSLFFAESKHQSRGVMMAV
FT                   FMSASSTILAFGLLAFSSTPAIHSFGLTLLLGIGFTFALSPFIQTFTRTFK"
     atgatagata aattggcact cagactgagt caatacccgg caaggctcaa atttgccctc        60
     tgggtaatgt tgctgtgcat caccacgtta acaggcatac agctttggca aggcggggct       120
     aagatccaaa gtgatatttt ggctatgctg ccaaagctca aagaagaccc cttaaccgaa       180
     accgccctcg cgcgggtcga agaacagcta tcaaacactg tctatatcgc cctactcgcc       240
     gaagataaaa gccaagccgt tactgcagcg aatacattga tagagagcct ttcatcggac       300
     aatcgagatg cattcgttga tataagaagt gccgatctca atcaggctca ggcactgaac       360
     catttctatt ttaatcatag atttaatctg ttaactcaag ctcaggcaag cgccctctca       420
     tccggcaagt taagcgaact gctccggcag gctcagcttc agctctacaa tgccttcggc       480
     tacgctaaca gtggcttaat cgctaacgac cctctactgc tttatccgga caacctgcag       540
     gcgcttgcac ctaaacaaag attacaggtg caacagggaa tactgctggg ccaatggtct       600
     cctaacgaaa ctgacgaaag ctcaaaaccg gcggctaagg tggccgcaat agtgatggcc       660
     aaaggattgg gtagcgcctt taacccaaac acacaagaat tacagatggc cgtgttacaa       720
     gaggcattcg agacggtcga gtctcaaaac aagcaggtag cgtttctcaa agccggcgcc       780
     ctgtttcatg ccagcgccgc gactaagagc gccaagagtg aagtctccac tctggggctt       840
     gcctcactta tcggcgtgag cttactcgtc tggctcgcct ttcgctccgt catgcctctg       900
     ggcatcgcgt tattgacgat aaccaccagc ctgctaacag cggtagtgat gacactgctt       960
     atcttctcag aacttcacct gctgacctta gtgtttggta ccagcctgat aggcatcgcc      1020
     atcgactata attttcactt ttattgcgag cgactggctc aagcagaaaa aagtgccaac      1080
     gagataatta gaaagatatt tccggcgatc acactggcac tgcttaccag tgtattggcc      1140
     tattccggca taggtcttgc ccccttcccg ggaatgcagc aggttgccgt tttctgcgct      1200
     gcgggtctgt tcggtgccta tatcacctta agcctagcct atccgctact cgcctcgggg      1260
     ccacttcctt cgggtgaaaa gcccctgtct atggctgcgg catacctgac aaaattaaat      1320
     tccatatcgc gttttttgaa ttataaaata gggggcgtgt tacttgccct atctgtcatc      1380
     atctccgcat ttggtcttta tcaactcacg agtgatgatg atattcgcaa ccttcaacag      1440
     agccctgagt cggtatcaga tgaagagcag caactcagag gtatcctcag tggcggaacc      1500
     gataatcaat ttttgcttgt tagaggagag actgaagagc aattactgca gcgactggaa      1560
     atactctccc ccaagctaaa caatgcagta gaaaaaggat tgattggtaa tgcttttagc      1620
     ctgagtacct accttccaag cagaagtaaa caagaggata attaccagct gcaggggctt      1680
     atttatcaac agaatttagc ctcgattgtt gaaaacctcg ggctcgatga ctccctgatt      1740
     tcagacttag cagaggcgta tcaaaaagcc aaaggaagct atatcgatgc agaatccttt      1800
     ataagttccg atgcaggtaa actgtttaag ccgctatgga taacgcccac acctttgcaa      1860
     gatcaatacg gggccatcgt gctgcttggc ggaataaccg agatagacaa acttgagagt      1920
     tttttctcca aactatccta cgttcagttg gtagatagag tcggtgagat atccggcgtc      1980
     atgggccagt accgacaatt aaccctctgg ctactcgcca tcgccatggc tatagcggct      2040
     ctcattttca gcactcgctt cggaataaaa ctggccgctt tagtggtcgc agttccggca      2100
     ctttcagcgg ttttgacatt gtcactactt gggctgatag gggctcctct cacactattt      2160
     catgctctgg cactcatcct cgtctttggg atcggcgtcg attacagcct gttttttgcc      2220
     gaatccaaac accagagtcg aggcgtgatg atggcggtct ttatgtctgc cagttcaacc      2280
     atcttagcct ttggactgct ggcatttagc agtacgccgg ccatacatag ctttggactg      2340
     acgctcctgt tggggattgg cttcaccttc gctctatccc cctttattca aacttttaca      2400
     aggactttta agtga                                                       2415
//

If you have problems or comments...

PBIL Back to PBIL home page