(data stored in ACNUC7421 zone)

EMBL: CP000821.PE317

CP000821.PE317       Location/Qualifiers
FT   CDS_pept        complement(370394..371197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34930"
FT                   /db_xref="GOA:A8FQ07"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ07"
FT                   /protein_id="ABV34930.1"
FT                   /translation="MKTRERSYSTWFATGLSRGKSVFGLLLLLSLSTFNVHATQSSNYD
FT                   TLFESSADNKRLQALADRLMIGESASGSFTQYRTLKVLKKPLISHGHFIFDSRLGLVWQ
FT                   QTQPFETTLILKEGELIQIDSAGRRQVSQAGSNQGAAAIAQTMPKLLSALLSGNLSDLS
FT                   EHFNLYLKADDTRNEPQEDEPAHWQLGLIPKDPLLVKAIPQMVLEGGEQVSALILLSNS
FT                   GDSSRIEFEQISKAPLSQEQRLFLSDRQGEDSPKVQPEAKPEPYP"
     atgaagacac gcgagaggtc ttatagcaca tggttcgcaa caggtttatc gcgagggaaa        60
     agcgttttcg gtttactcct gctgttgagc ctgagcacat ttaacgttca tgcgacacaa       120
     tcttccaatt atgacactct ttttgaatca tcagcagaca ataaaaggct gcaggcatta       180
     gccgatcggc tcatgatagg agagagcgcc agcggaagct ttactcaata ccgaacactc       240
     aaggttctga agaagcccct gatcagtcat ggacacttta tttttgattc tcgactcggc       300
     cttgtgtggc aacagactca gccctttgaa acgaccctga tattgaaaga gggggagttg       360
     atacagatag atagcgcggg cagaaggcag gtatcccagg caggttccaa tcagggagcc       420
     gcagctatcg cgcaaaccat gccgaagtta ctgtcggcac tgctgagtgg taacttgagc       480
     gacttgagtg agcactttaa cctgtacctc aaagccgacg acactcgaaa cgagccacaa       540
     gaagatgaac cagctcattg gcagctgggg ttaatcccta aagatcctct gctcgtcaaa       600
     gctatccctc aaatggtatt agagggcggg gagcaggtat cggccctgat cttactgagc       660
     aacagtggag acagtagcag aattgagttt gagcagataa gcaaggctcc actttcgcaa       720
     gagcagcgac tctttttatc agataggcag ggtgaggatt ctcctaaggt tcagcctgaa       780
     gccaagccag aaccttatcc atga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page