(data stored in ACNUC7421 zone)

EMBL: CP000821.PE318

CP000821.PE318       Location/Qualifiers
FT   CDS_pept        complement(371194..371673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0318"
FT                   /product="thioesterase superfamily protein"
FT                   /note="KEGG: slo:Shew_3518 thioesterase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34931"
FT                   /db_xref="GOA:A8FQ08"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ08"
FT                   /protein_id="ABV34931.1"
FT                   /translation="MTKLSGKAILTIELEMLIPFHDVDSMGITWHGNYLRYFEIARCQL
FT                   LDKIQYGYREMQASGYSWPIVDLQIKYVQPSTFEQKIKVIASLVEWENRIKINYQVRDV
FT                   VTNQRLTKGYTIQAAVETETNELCFVTPDIFREKIAHLIEKHASQNPVVSEGSGR"
     atgactaagc tatcgggcaa agccatctta accattgagt tagagatgct gatcccattt        60
     catgatgtcg actccatggg gatcacctgg catggcaact atttgcgtta tttcgaaata       120
     gcccgttgtc agctattaga taaaatccaa tacggttacc gggagatgca agcctcaggt       180
     tactcctggc ctatcgtcga tctacagata aagtacgttc aacccagcac gtttgagcaa       240
     aagattaagg ttatcgcctc actcgtcgag tgggagaatc gtatcaagat caactatcag       300
     gtcagggatg tcgtcactaa ccaacgactc accaagggct acacaataca agccgccgtt       360
     gaaactgaaa ccaacgagct ttgcttcgtg acgcccgata tcttcagaga aaaaattgcc       420
     cacctgatag agaagcacgc ctcccaaaac ccggtagtat ctgagggaag cggccgatga       480
//

If you have problems or comments...

PBIL Back to PBIL home page