(data stored in ACNUC7421 zone)

EMBL: CP000821.PE32

CP000821.PE32        Location/Qualifiers
FT   CDS_pept        complement(38087..39496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0032"
FT                   /product="TrkA-N domain protein"
FT                   /note="KEGG: slo:Shew_3739 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34645"
FT                   /db_xref="GOA:A8FP72"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP72"
FT                   /protein_id="ABV34645.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDNDRSRLRSLQDKYDL
FT                   RVVFGHGAHPNVLKEAGAEDADMLIAVTNSDECNMSACQMAYTLFGTPTKIARIRSEQY
FT                   LALRDKLFINTETKKNDNSPRGGFIIDELIAPEQLVTAYIRRLVEYPGALQVLEFAEGR
FT                   LSLVAVRAYYGGPLVGNALAALREHMPNIDTRVAAIFRQGRPIMPRGTTIIEADDEVFF
FT                   VADSRHVRAVMSEMQKLDNSYRNIMIAGGGNIGFGLAQQLQRNHSVKLIEHRQERAEEL
FT                   SEKLENTTVFCGDASDQELLLEEHIDQTDVFIAVTNDDEANIMAALLAKRMGAKKVMVL
FT                   IQREAYVDIVQEANIDIAISPQQATISALLTHIRQGDICNVYSLRRGAAEAIEAIAHGD
FT                   SKTSKVVGKQIGNIKLPPGTTIGAIVRDEEVLMAHDKTVIEQGDHVILFLVNKKFIGEV
FT                   EKLFQPSAFFF"
     atgaaaatta tcattttagg tgcaggtcag gttggtggca cactagccga aaacttagtc        60
     ggcgaaaata atgacatcac tatcgtcgat aacgatagaa gtcgattacg ctcgctgcag       120
     gacaagtatg atctgcgggt tgttttcggt catggtgctc atccaaatgt cttgaaagag       180
     gctggcgccg aagatgccga tatgctgatt gccgtcacca acagtgatga gtgcaacatg       240
     tcagcctgtc agatggcata cacgcttttc gggacaccca ctaagattgc ccggatccgc       300
     tccgagcaat accttgccct aagggataag ttgtttatca acaccgaaac caaaaaaaat       360
     gataatagcc ctcgtggcgg ttttattatt gatgagctga tcgcacccga acagctcgtt       420
     accgcctata ttcgcagatt ggtcgagtac cccggtgccc ttcaggtcct ggagtttgcc       480
     gagggccgat taagtctggt tgctgttcgt gcctattatg gtggccccct cgtaggtaac       540
     gcactggccg cccttcgcga acatatgcct aatattgata cccgggtagc agccatcttc       600
     aggcaggggc gccccatcat gcctcgcggc accacgatta ttgaagccga tgatgaagtt       660
     ttcttcgtcg ccgatagccg tcatgttcgc gccgtcatga gtgagatgca gaaactggat       720
     aactcctatc gtaatattat gatagcgggc ggcggtaata tcggtttcgg gctcgctcag       780
     cagttacagc gtaatcactc ggtaaaactg attgaacatc gacaagagcg tgcagaagag       840
     ctgtctgaaa aactcgaaaa caccactgtt ttttgtggtg atgcctccga tcaagagcta       900
     ctcctcgagg agcatatcga tcaaactgac gtgtttattg cggtaaccaa tgacgatgaa       960
     gccaatatca tggcagccct actagctaag cgcatgggcg cgaagaaggt aatggtgcta      1020
     attcaacgcg aagcttatgt ggatatcgtt caggaagcta atattgatat cgcaatatct      1080
     ccacaacaag cgacgatctc ggcactgctc acacatattc gccaaggtga tatctgtaat      1140
     gtgtactcac tcaggcgcgg cgcagccgaa gctatcgaag ctattgccca tggcgactca      1200
     aaaacatcaa aagttgttgg taaacagata ggcaatatca agttaccccc cggcacgacc      1260
     atcggtgcta tcgtccgtga cgaagaggta ttgatggctc atgataagac agtcatagaa      1320
     caaggcgatc acgtcattct cttcctggta aacaaaaagt ttatcggtga agttgaaaaa      1380
     ctgttccaac caagtgcttt cttcttctag                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page